SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP002272-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP002272-PA
Domain Number 1 Region: 404-797
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.61e-129
Family Ankyrin repeat 0.00000000136
Further Details:      
 
Domain Number 2 Region: 168-422
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.56e-76
Family Ankyrin repeat 0.0000023
Further Details:      
 
Domain Number 3 Region: 15-232
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.09e-56
Family Ankyrin repeat 0.0000123
Further Details:      
 
Domain Number 4 Region: 1414-1494
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000774
Family DEATH domain, DD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP002272-PA   Gene: AGAP002272   Transcript: AGAP002272-RA
Sequence length 1495
Comment pep:novel chromosome:AgamP3:2R:18435241:18452927:1 gene:AGAP002272 transcript:AGAP002272-RA
Sequence
FLHSYSLQSDGNTSFLRAARAGNLEKVLEHLKNNIDINTCNANGLNALHLASKDGHVAVV
TELLARGATVDAATKKGNTALHIASLAGQEDVVKLLIKHNASVNVQSQNGFTPLYMAAQE
NHDSVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAA
KKDDVKAATLLLENDHNPDVTSKSGFTPLHIASHYGNEAMANLLIQKGADVNYAAKHNIS
PLHVAAKWGKTNMVALLLEKGASIESKTRDGLTPLHCAARSGHEQVVDMLLERGAPISSK
TKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRN
ADANARALNGFTPLHIACKKNRIKVVELLLKHGASISATTESGLTPLHVASFMGCMNIVI
YLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLG
NVDIVMLLLQHGAQVDAVTKDMYTALHIAAKEGQDEVAAVLLNNGAQIDATTKKGFTPLH
LTAKYGHMKVAELLLEKSAPVDAQGKNGVTPLHVASHYDHQNVAMLLLEKGASPHATAKN
GHTPLHIAARKNQIDIANTLLKYEAQANAESKAGFTPLHLSAQEGHTEMSGLLLESKANP
DHQARNGLTPMHLCAQEDRVSVAQVLVKHGANLQAATKAGYTPLHVASHFGQANMVRYLI
EQQVDVNASTGIGYTPLHQASQQGHCHIVNILLESNADPNAITNNGQTSLKIAQKLGYIS
VLDSLKSVTDAKATPDQPPSEEKYRVVAPEAMHETFMSDSEEEGGEDTVLSDQPYRYLTV
DEMKSLGDDSLPIDVTRDERMDSNKMVQSTDSHQFPPTALEDSISPQHASMVQSGISATD
FTDNINIERHSHVGKLHWKNFLVSFLVDARGGAMRGCRHSGVRIIVPARSAAQPTRITCR
YVKPQRTMHPPPLMEGEALASRVLELGPVGAKFLGPVIMEVPHFASLRGKEREIVILRSD
NGETWREHNIDMSDEIIHDVLNECFEPEELAQLDELGGGRICRFVTYDFPQYFAVISRIR
QEVHAIGPEGGMVSSTVVPQVQAVFPQGALTKKIKVGLQAQPIDPDLTAKLLGRGVAVSP
VVTVEPRRRKFHKAITLSMPAPRAHSQGMINQYSGSAPTLRLLCSITGGTTRAQWEDVTG
STPLTFVNDCVSFTTTVSARFWLMDCRNIADATKMATELYKEAIHVPFMAKFVVFAKRTD
PLEARLRVFCMTDDREDKTLEHQEHFTEVAKSRDVEVLEDKPQYIELAGNLVPVTKSGEQ
LALPFKAFRENRLPFAVRVKDQHADIVGRTLFMREPKIAKGEPPQQPICILNIVLPETII
PEQTTTITDSHEIMLRVGRVRAVVPPRQLVDDQNYLGELRIVDISNLLGEDWIRLAPEIG
VSETDVENIVAQIPASTAQQAQAMLKQFQSKPNNDFNILENGLRTIHRDDIVERC
Download sequence
Identical sequences AGAP002272-PA 7165.AGAP002272-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]