SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP002310-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP002310-PA
Domain Number 1 Region: 456-584
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-26
Family Cadherin 0.0022
Further Details:      
 
Domain Number 2 Region: 362-468
Classification Level Classification E-value
Superfamily Cadherin-like 8.28e-25
Family Cadherin 0.00099
Further Details:      
 
Domain Number 3 Region: 660-773
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-17
Family Cadherin 0.003
Further Details:      
 
Domain Number 4 Region: 566-672
Classification Level Classification E-value
Superfamily Cadherin-like 7.57e-17
Family Cadherin 0.0015
Further Details:      
 
Domain Number 5 Region: 900-1044
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000137
Family Cadherin 0.0026
Further Details:      
 
Domain Number 6 Region: 259-358
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000133
Family Cadherin 0.0036
Further Details:      
 
Domain Number 7 Region: 43-153
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000004
Family Cadherin 0.0043
Further Details:      
 
Domain Number 8 Region: 800-912
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000757
Family Cadherin 0.01
Further Details:      
 
Domain Number 9 Region: 146-258
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000343
Family Cadherin 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP002310-PA   Gene: AGAP002310   Transcript: AGAP002310-RA
Sequence length 1494
Comment pep:novel chromosome:AgamP3:2R:19074789:19080427:-1 gene:AGAP002310 transcript:AGAP002310-RA
Sequence
DRSRNASERLSATTTLTIDIADSDDQDPSFIYRGCVLLDGACLNPEYSASVPAGTLQGVL
TVTPERIQAVDLDTISAPIRYSFLSGIPGNYGDYFEIDPQTGVLKQTKLVDGSVTAKKFD
LVVKAEEVSDMKRFTTAKLSIHVKPVDAYPPMISITATEGFVDENSPIGTVVMDAHGSPI
KLSTTDQDLGPDGEGMEYIYEVTTPSFTVSKEGVLRVNEEGLDRDPPSPGKYLFQVVARE
ASGNAASAPMSLTVHLRDVNDNAPRLAMVAPVTLMAGDGRRLVTQVHATDNDAAENAAIT
YSIFHVSNNGASKFGIDPATGEIETRTRLNAGEQYSITVQASDVGGLSSQAIVEVTITPG
PNTKPPRFARPVYEVQVSEGAEINSTVIVLKAEDPENDPVSYAITTGNDLRQFSIGKDSG
VISVIRKLDREDLTRYQLIVRAEDNGGLASSATVNIKVTDINDKNPEFDERQLPYVFAVD
EGRENVSIGTVRATDADEGMNAEITYTVPSDIPFRIDSRTGEVRTKVALDYEKQKEYRFV
VTAKDGAPEPRLGTASVTVKVRDVADEVPRFMESTVEIKVPENVPDMTVTTVRAFDPDTK
PEITYTLRRGPGDLFKVDARTGQIKTIRGLDYEKDKMHELLVGTLENNGTGAGDYIRVLV
EVEDRNDIPPVFVSIPEPVSINDNLPIGAIVGSMPAVDGDGSSPGNVVRYELVGRGKALK
YFQVDADSGIVRIRDDLGKEEDSEYLIDVRAFDMGEPQLSSVSTLPVYVGHIPANPNGDS
AESRLESGGIVNLEVQGLAFSDDSYTTSVPESTGVNATIKLIQIINSKKATKHNGGFSCE
LAGDDTVRRLFRVTIEDHACALALAAPLDYEAATSHQLEVRLASSKYFVNQHRNAATVKV
IVQDENDNVPQFVIPRTYQQSARNDTYYAVIGADADIDTPVLQVKATDRDMGPYGQLKYA
LLDVDGQANEIAPEDAPSTYFTVSEDTGMLKTQKPLQQVRQTPLVFLVEARDNNGNATAG
AIVHRARARVVVNLIADINRMALVFLDSNPKDMRRHARNLEELLHEKTDGLITGIERFAV
RKVLNENGTAEEVAGATDVWFYAVDPQTERILERNSSTVAKRIFAPAVLSQINFEASSIA
RATAQGIFGPIEPKLPIQKIKATIVGNEDVFPFALIAVAIVILILGSIGIVYICISWSKY
KNFKQRMRQYTAPATSPVRYDPVMINSQQQPPSDNPTSLKEYETQVLAMAVPLADEGDDL
QLDFSAKNHAFSLDNVSYITHKENGQSEHSPTNSDATTAVVGTLQRNNNNNTKNNNNLNI
NNRQNTLNRTLEMNRNNYLNPLGSGGNGGPVVPGTLTLGRIKSERNNYINGYGDTLNRNN
LTMAQNNTFNTLGRNQRNINHAPHHNNANHGSNNVNLNQGHHHHPMHNGGPGVGGYAGTE
IVTNTLGRNNRYNDLNHISPTNENVSFGKRDYNQLSFSYLNDLDRSDAETTTEL
Download sequence
Identical sequences 7165.AGAP002310-PA AGAP002310-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]