SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP002672-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  AGAP002672-PA
Domain Number - Region: 672-714
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000838
Family Merozoite surface protein 1 (MSP-1) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP002672-PA   Gene: AGAP002672   Transcript: AGAP002672-RA
Sequence length 924
Comment pep:novel chromosome:AgamP3:2R:25293763:25307478:-1 gene:AGAP002672 transcript:AGAP002672-RA
Sequence
PTEQPTLPPEGQIPLERLPSNTLLKYTAYKDVSILHFRIPSDTRTAFFSFKAYEESKGAF
QRNCKPNDITLHLKAGSYPVISPENITFPKHFLDAEERFEIHSLQFKSDSTTRRLSIEGP
HPGNWFAVAFISWTDPNNERIEQQGKCRCCDGVGKEFRENCVSAPKTRTGTSERARTIRR
ANGSHHPSKSDSTPFGVPLKRGVLEHDTPDTGPAGNSMAVVSARPQLLNVDVRYEGTLVA
DQPEPRSFKFFVPHNVSIVTWRLSIAQPCFNCTDVSFHVQASALPTARNYLQNALICPNQ
TGDVSIDFYPHEGAWHYAQMVAFTVELIYHDTYDAGVGSTAAAAAATPTTPSTEDPTPAD
ASGDAAEDSAEGPAADTKSLPNRSFDRYPVLRQTYREFFMFDYDLLPDVNGTVPVTLNLT
AGVPALMKFDVNDVYDIGGTLSFAVAMRQDLKGSLIDARHESTNEHASVVAEKLVDVQEE
FVPETAPAGKANQTVIVCLRLEEPGIPTWPDKCVYGRHIYPAAIVINNTDADTNTGLVHV
PFPEPGSWYVTLGLFCHGTEATARSTIIDSVKDFVRSYRATLAAMRAPCSCADRLSYYRG
CLADDGCLQALNETETLKIKECIMDAKCTGGRSDEMARKFEQHHKYATEQSVQGGVADST
CNSSVVFTISSSPCVAGRCGRFGRCYHYMSGGFVFSTCLCLRNYRGWDCTEDSQVPSSAS
ILLASLMLTLSNLLFLPSIFYAVKRGYHSEAIIYFFAMFFSAFYHACDSGEEEFSFCLVK
IGVLQFCDFYCGLLAIWVTLIAMSNIRHQLVSLLHMLGAILLAFGTELNKQSLWVFLAPA
LTGICLISVSWGLRCRKTKRCFPARSYLALYLPIGSVLVMVGLVCFAFLQTKQNYHIVHS
IWHMVMALSILCLLPDRKTFHPKC
Download sequence
Identical sequences AGAP002672-PA 7165.AGAP002672-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]