SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP002793-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP002793-PA
Domain Number 1 Region: 438-578,634-784
Classification Level Classification E-value
Superfamily L domain-like 4.42e-55
Family Ngr ectodomain-like 0.00000194
Further Details:      
 
Domain Number 2 Region: 1-201
Classification Level Classification E-value
Superfamily L domain-like 1.87e-43
Family Ngr ectodomain-like 0.0019
Further Details:      
 
Domain Number 3 Region: 214-419
Classification Level Classification E-value
Superfamily L domain-like 2.78e-41
Family Ngr ectodomain-like 0.00066
Further Details:      
 
Domain Number 4 Region: 1054-1243
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-39
Family Laminin G-like module 0.0032
Further Details:      
 
Domain Number 5 Region: 982-1027
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000105
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 6 Region: 901-942
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000743
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 7 Region: 866-909
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000182
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 950-987
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000015
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 9 Region: 824-865
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000204
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 10 Region: 1267-1306
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000671
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP002793-PA   Gene: AGAP002793   Transcript: AGAP002793-RA
Sequence length 1400
Comment pep:novel chromosome:AgamP3:2R:27614907:27628492:1 gene:AGAP002793 transcript:AGAP002793-RA
Sequence
DLQGNNISVIYESDFQGLAKLRILQLTDNHIYTIEKDALHDLISLERLRLNSNRLKSIPD
NFLSSAANLLRLDLSHNALTAVPKRAFKGAPALRSLQLDNNQITCLDEGAVKGLTELEIL
TLNNNNITTLPRDMFAGMPRLRALRLSENPFACDCHLSWLARYLKNASRLAPYTRCHSPG
QLKGQNVADLHEQDFKCSGLTENAPMECGGRSLCPHPCRCADGIVDCREKSLTTVPSTLP
EDTTELRLEQNYITEIPPKAFANHRRLKRIDLSNNNISRVAYDAFSGLKSLTSLVLYGNK
IKDLPASVFKGLTSLQLLLLNANEISCVRRDAFKDLHNLSLLSLYDNNIQSLANGTFDSL
RSIQTLHLARNPFICDCNLRWLGDYLHQNPIETSGAKCDAPKRMQRRRIEALKDEKFKCT
DDYSKIKYSGECRMDQECPAACHCDRTTVDCSGRGLKEIPRDIPLYTTELLLNDNELNRI
KSDGLFGRLPNLAKLDLRRNQISGIEPNAFEGATRIQELFLSENKIAEVHNKMFLGLHQL
KTLSLYDNIITCVMPGSFDYLTSLTQLNLASNPFRCNCHLAWFSDWLRKKQLNGPPARCT
SPSKVRDVPIKDLPHFDFKCTSDMDQGCLGEGYCPPSCTCTGTVVRCSRNKLKEIPKSIP
AETTELYLESNEISMIHSNRISHLKALTRLDLSNNQIGILSNHTFANLSKLSTLIISYNN
LQCVQKYALAGLTNLKVLSLHGNKISMIPEGTFNDLQSITHIALGSNPLYCDCSLRWLSE
WVKRDYVEPGIARCAEPEPMKDKLILSTPAAQFVCSGKVSNEILSKCDACYTFPCKNEAT
CSALPERQYECKCKPGYHGTHCEFMIDACYGNPCRNNGTCTVLEEGRFSCHCLQGYTGSR
CEVNIDDCVGHKCQNNGTCVDGVNSYSCSCAASFTGEYCESKIEFCGKDFNPCQNGAKCV
DHTTHYSCDCLPGYRGLNCTDNIDDCVNHMCQNGGTCVDGINDYTCKCPHEFTGKFCEGA
PMVAMMYPQTSPCQQHECKFGVCFQPNPSSADYICKCAPGYSGKRCEYLTSLTFLHNNSF
VELEPLRTKPEANVTIVFSSTQQNGVLMYDGHNEHLAVELFNGRIRVSYDVGNDPVSTMY
SFEMVADGKYHLVELLAIKKNFTLRVDRGLARSIINEGSKDYLKLSSPMYLGGLPAEPGQ
QAYKQWHLRNLTSFKGCMKEVWINHKQVDFLNAARQQKITPGCALLEPDSEGEMDDEFMQ
ETPVILKEVNPCENHQCKRGGKCVPNGKGGYTCKCKKGTKGKYCDQGEGSVSLVIDEDPF
KTSSSASTCRKEQVREYYTENDCRSRQPLKYAKCVGGCGNQCCAAKVVRRRKVRMVCSNN
TKYVKQLDIVRKCHCTKKCY
Download sequence
Identical sequences 7165.AGAP002793-PA AGAP002793-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]