SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP002828-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP002828-PA
Domain Number 1 Region: 1234-1351
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000432
Family Cadherin 0.017
Further Details:      
 
Domain Number 2 Region: 1124-1246
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000171
Family Cadherin 0.0073
Further Details:      
 
Domain Number 3 Region: 168-266
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000249
Family Cadherin 0.011
Further Details:      
 
Domain Number 4 Region: 390-541
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000011
Family Cadherin 0.0057
Further Details:      
 
Domain Number 5 Region: 649-769
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000002
Family Cadherin 0.0019
Further Details:      
 
Domain Number 6 Region: 276-392
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000314
Family Cadherin 0.018
Further Details:      
 
Domain Number 7 Region: 758-904
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000999
Family Cadherin 0.0049
Further Details:      
 
Weak hits

Sequence:  AGAP002828-PA
Domain Number - Region: 517-650
Classification Level Classification E-value
Superfamily Cadherin-like 0.000642
Family Cadherin 0.005
Further Details:      
 
Domain Number - Region: 880-969
Classification Level Classification E-value
Superfamily Cadherin-like 0.00685
Family Cadherin 0.0062
Further Details:      
 
Domain Number - Region: 1034-1115
Classification Level Classification E-value
Superfamily Cadherin-like 0.0102
Family Cadherin 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP002828-PA   Gene: AGAP002828   Transcript: AGAP002828-RA
Sequence length 1561
Comment pep:novel chromosome:AgamP3:2R:28059368:28066311:1 gene:AGAP002828 transcript:AGAP002828-RA
Sequence
SEGGRWSIVINRRQDYEVHQRSSLILLAVESTAIPYAIVVNLVNVLDNAPVMTAQGSCEI
EELRGDFVTDCLFNVYHADGFEENGIGNSSTNELSFEIGDVAGARDHFTYVPSTVTPSQP
IYNKLFNLKVLKQLDYTENAIFNFITTVYDLDRTHSFKMSTIVQVRNVDSRPPIFSRPFT
SERIMEKEPFYATVIAIDRDTGLNKPICYELTALVPECKQAKYFEIGQTDGKLTVHPIDR
DAEQNELYTFTIVAYKCHNRLLNTSSEGAIILLDKNDNIPEIYMKPLELEFWENTIMELP
FDELVIHDRDLGENARYEVRLAETVAGVQQTTDSFTIIPGNGYQRVSFTININNATSLDY
ELPERQTFVLHVTAHEPIEPTHESTQPITIRLKNWNDEVPKFGRDEYQISVPETIGAGEL
LATVTVTDRDIDDGIRLFALGRLAESLSVTELPVSAEPETNLPLYGFEIATKVGDIFDYD
IAKEVIVQLQAEDTLRTAKQESLHQIFSQLTITVIDVNNKPPQITLPRGTMHILENSVPD
SAVIIGEEQIAQIIGTDPDTEAELEFSIDWSNSYGTKSGIRAKAETYENCFYIHEEKVNR
QRTIGTIRVNPTFPLDVDHEMYDTLFLVIRLVDRNQTILPNTVETVVAIQIDDENDNAPY
FDNSTLTVVRSVKERSDSGVTIGNIIAHDIDGPGNNEITFAMEPIDPAHKGWMNIDDNGI
VRVEGNRSIDCDIPPIDKVLQNVTISDWKWSNWHVFEIVLMDTNNKQPYHDPFPNDGQVY
QFEKIPSNTAIVRVEGKDQDRDVPYHTVSYEINYRDFPQLQRYFEVDSTGRVYVKENNDL
LDRDAGLESIMINIVMLDNAGGYDIQNRVSTNINLTLLDINDHTPKLPELAADELKVSEN
AKQGYIVKTPFAALDLDDKRTPNAKINYYIEEMTPGTRCMPLANQLETPLFSLENIDEYN
AVLRVAQDLKGFYGTWTLKIKVKPKDNCETRDYELTVEPFNYNTPSITYPSRSAQLRLKY
ESLQNGRPLVETNGSPLPKFEAIDDDGGIYGDVTFSLTSTNGKLSTSGLTDPDPIGKRFD
FSPPTRVIIERYSIPQITVIARDGGDRQSEAAIHVVFINMTGEPAFLEPTFDTDFTENEE
GRDERRQLPFAEDPKNAGLPPGAETNVYYFIDKTYGNASHLFQLDRVSNVLQLAQLLDRE
EIPTHEIRIVATNNENGPPDTVLESSPSLLVVRIKVNDVNDNPPVFQQRLYAAGITTNDR
VPKALFRVYAEDPDEDEIIRYELVNGTAVGENLQTDGLPFRLHPDSGELTLTSKVQPNQN
GYYQLTLIAFDRDDTHNDTVPAKVYIVSESNRVTFVFLNSVEEIDQPDVRKFLAQELTGA
YEMECNIDDIDQTTASDGRQAGGSSSALTDVRTHFIQDNQAVEASRIQQRSSNRTFVTVL
KTTLRTRGLSLQDVPPLATEALTEADETLQIILIVVSAALAVLCVILFVAFFIKIRSLNR
QLKALSATDFGSISSELNGKPTRNVPTTNIFSIEGSNPVLNDNEFRDRMGGSGGGVYDDL
R
Download sequence
Identical sequences 7165.AGAP002828-PA AGAP002828-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]