SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP002966-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP002966-PA
Domain Number 1 Region: 219-513
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.55e-68
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 32-139
Classification Level Classification E-value
Superfamily DEATH domain 1.01e-26
Family DEATH domain, DD 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP002966-PA   Gene: AGAP002966   Transcript: AGAP002966-RA
Sequence length 516
Comment pep:known chromosome:AgamP3:2R:30248384:30250372:-1 gene:AGAP002966 transcript:AGAP002966-RA
Sequence
CMLCPIMSKPNGQHTEMEGKPSGLSAATTVAPLSNFVYIYDIPRMEKKRLAALLEVNNKW
YELGEKQMGYSTVELDSTQRCCQRNNRSPAEQLLDKWGNYNHTITELFVVLSREKLYNCM
ELIKRYVDSRYHVLIKESASDGRNAVANMATFSGANNNANVPNGHRAAHRLKDGAADQKV
NGGGGDGAAAAAAAATNDKSNPTNSKENSPFANELADLTSLIPKISYEELTAATDNWSER
NILGKGGFGTVYRGNFKHTFMAIKKIDYNKVKSSEAERIQLQQSFNELRFLNSCRHDNIV
PLFGYCIEKEPCLVYQFMPGGSLDKSLFARRPASPLTWRERMNIAIGTARGLQYLHTFGD
KPFIHGDIKPGNILLNEYKQPRIGDFGLTRQGAVQDSATVVSRVYGTRPYIPKEFYDRRE
LSTKVDTYSFGVVLYEIGTGLRAWDERRTEKHLKDYIARAVQEQMHVTQLADQSLPMDAE
ALMCCFKLLQVGRVCTADDPKQRPDMVGVMWQLSAA
Download sequence
Identical sequences AGAP002966-PA 7165.AGAP002966-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]