SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP003496-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP003496-PA
Domain Number 1 Region: 186-383
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.53e-57
Family Reprolysin-like 0.0000715
Further Details:      
 
Domain Number 2 Region: 399-475
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 8.11e-19
Family Blood coagulation inhibitor (disintegrin) 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP003496-PA   Gene: AGAP003496   Transcript: AGAP003496-RA
Sequence length 685
Comment pep:novel chromosome:AgamP3:2R:38670944:38697741:1 gene:AGAP003496 transcript:AGAP003496-RA
Sequence
GPHRERLTIQYGMQGETMTLDLTLNENIIPEEYTFVHQSPEGQDIVERLDRQSVELCHYE
GTVRERPGSRVAISTCSGSIDGVIYERNETYLIEYHNNTHLLYRRRYKRDVQDNELANEE
AGGSRPRNNQQPAFSTGYREDADSLFVELVLVVDRTLFLKFSSNVQRRTKRNHLSTIKGP
YQANAHSSYVELLLVADNSLFRKLDQDMWQVYHYCASLVNHINMLYNPLNIYIALTDVVV
WRDTDRINVSTRAEETLNSFLAYRSSVLLHDHPHDHAQLLTTIEFKDNVIGKAKVGGMCS
DRSSGAIVRVHTDDVGVQASTLAHEMGHSFTMEHDEDGDCACPDRKCIMTRTVTGLTLQH
WSNCSLQQLSTALGRGLHHCLSNRPSQLAFESCGNGFVESGEECDCGLEEACENRCCDAR
TCRLREGAQCATGECCDLETCQLREPAVPCRGQRSECDLPEYCTGRSEYCPPDVHRRDTE
PCAGGEAHCMAGRCRTRTDQCRALWGPSGHAASEACYEANAKGIKYGNCGYEGRPAESFR
KCAPADVQCGLLFCHHHKADEELELGEYNGDSRYSVQKGNETMRHVLCRSAYVDLGEGQG
RHPAFVPDGSPCGEGRMCYRQRCESVERLNAWGIGGKVCAHGCFGRGVCNSEGHCHCQQG
YDPPYCEHQGVGGSLDSGPASTETG
Download sequence
Identical sequences AGAP003496-PA 7165.AGAP003496-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]