SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP003498-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP003498-PA
Domain Number 1 Region: 225-419
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 8.6e-61
Family Reprolysin-like 0.0001
Further Details:      
 
Domain Number 2 Region: 436-513
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 1.86e-17
Family Blood coagulation inhibitor (disintegrin) 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP003498-PA   Gene: AGAP003498   Transcript: AGAP003498-RA
Sequence length 1368
Comment pep:novel chromosome:AgamP3:2R:38727779:38733747:1 gene:AGAP003498 transcript:AGAP003498-RA
Sequence
DDQRFHPSKEFSHYGRIVPQLRHGRHKRSLTNTREENGLHASHLTLSYTLNEADVILDLQ
LNKRLIPDGHFLSYQLPNGTGKHVIRYNRPEEVDLCHYQGKIRGKPDSSAAISTCGETEG
IRGIIIDTDDTYYIESPLTSANAAQGNGKTASINLGEHFIYRLVGRRLNACAKSHDLWHT
LDETAINGLTFIDPPFALQREKRATSSGSSSPKIRGPYNANKYSSYVELVIVVDNKMFKT
MRENFKTVQQYCKDITNIINALYEPLNIFVGLVGVVVWNEGDEIELSKDGEVTLKNFLHY
RKKTLIKDHPNDNAQLFTKEHFDGGVVGKALKGPICTYEFSGGVEMYHSEIIGVQATTVA
HEMGHNFGMEHDTADCECPEERCIMSASSSSIAPKHWSRCSIDQLSLAFHHGMNYCLMNK
PESLFDSPVCGNGFVEAGEQCDCGLPDYCDNSCCDPRTCMLHSNASCATGECCDLRTCKP
MIGGTVCRQADGECDLPEYCSGESEYCPGDVFKRDTEVCDGGKAFCYRGTCRSQNDQCRL
LWGPTGKSSEQCYVKNEDGSRHGNCGYNRVKNEYVKCDGADVHCGMLHCRHLNERLEFGM
ESVAILSHSFMTYNGSVIPCRTAIVDLGLQKVDPGLTPDGAKCGEGKMCLNQMCMSVEKL
RASGSGAACPENCNGNGVCNSEGHCHCDLGFAPPLCNLDGFGGSLDSGPASDPNAMVAFR
RMMYIFFCGVVPVCTIFAFVVYYIRNGHLTTHIKPDGSHSASSTHTMLPSSPNSPDSDMN
AALLRPSSTISTTVAPNESDFVANNNMFGKFKGFTLQPLPQSTVGGGATAVHKKTPKVAF
VQPVAKCSEDTTSNAVPARAAPPVPLANHEHQLDTSSAPALPPMNPGSTARPIISSPILE
SSTARDLVVAGVKGQKAASNVPIRPAPMLPPAKESKLNRITSYLKKEEKPPKPEPKQLKV
IDKEKLRNIDISAPIPIDQNNPELAKSMPRLADGANDEKQQAAVAASVQRAKSMRDPPES
TRPQSMVGTRPTIPPPRPPVPGAVVQTTAAMKIPGLPGYQNPVPAKSVRIMAPAGNGGGA
NERSEYDDCRDSGNGTGQSSLGSDNIYSVIDESPSPPSILSPPAISSGGSSESMGLLGEI
VNEIESRNGDSVYIATPIARITPSTGNGTGTEKAAPASGVSSFKSTAPSNATTRATNGTG
SVLNQLKFQGPAAKEAPKKATASAGTANGTNGQSSYKPYHSVLTNNARAGSVVAAAKAKI
AAEKTSSTTPATTTTNNTTKKLPSQANASVRTRTPSPRGSIGNGSLPNGTVPGKGTATTT
TAGTKPKTAAKPTAAAIGNGKLLTAAARPGPGKVSNVASLQQKFESKK
Download sequence
Identical sequences 7165.AGAP003498-PA AGAP003498-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]