SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP003506-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP003506-PA
Domain Number 1 Region: 428-629
Classification Level Classification E-value
Superfamily Kelch motif 4.71e-30
Family Kelch motif 0.006
Further Details:      
 
Domain Number 2 Region: 270-435
Classification Level Classification E-value
Superfamily Kelch motif 5.36e-17
Family Kelch motif 0.0092
Further Details:      
 
Domain Number 3 Region: 74-210
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-16
Family Spermadhesin, CUB domain 0.0028
Further Details:      
 
Domain Number 4 Region: 917-964
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000234
Family Laminin-type module 0.035
Further Details:      
 
Weak hits

Sequence:  AGAP003506-PA
Domain Number - Region: 217-244
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00138
Family EGF-type module 0.082
Further Details:      
 
Domain Number - Region: 46-77
Classification Level Classification E-value
Superfamily EGF/Laminin 0.01
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP003506-PA   Gene: AGAP003506   Transcript: AGAP003506-RA
Sequence length 1288
Comment pep:novel chromosome:AgamP3:2R:38764084:38771349:1 gene:AGAP003506 transcript:AGAP003506-RA
Sequence
MVGGRPASPHSSVWRLVLLVLLALSCQLGPTVLVSSHGLAGVADPGKCSEVRCMNGGVCK
NGTCLCPDGWQGSECQFCGGKVRLTEPSGSIHDGLGNYSIGVKCSWLIDAREHNSITDKV
STEPGRPSVIRLHLEEFATECGWDHLYVYDGDSVESPLLAVFSGLMYRKNFTIRRIPEVF
AHSGSALLHFFSDDAYNMSGFNISYQVNACPTNDSSLNCSGNGDCWNGECSCNSGFTGAA
CNIPRCPNYCSAHLGRGVCDRKQQRCVCSAGYTGNDCSQAIAHGYWTAIDAGETEGFTPP
GSASHGAAVFHDTLYVIAGESYGKAEALLYMYDFNGKVWETAHTESRPAPELRYGASTVI
FGDKIFMYGGVIEGRGVCGELWAFDVSAKIWENITVKAEQCNDTYEMCGPLRSAGHTATI
VSNYDQVGGKKVLTGGGSSQKMVVIFGHSPQFGYLNTVQEFNFGTREWRIVPTRGYPVKG
GYGHSAAYDPLRERIYVYGGIVSESDSSQLLSNKLYSYEPHERLWTLLETAPTARFLHTA
NFLTPGLMMVFGGNTHNDTSHSFGAKCYSRDLMVYDVLCDSWHAQPMPDDLYADLARFGH
SAVVFERSLYVYGGFDGQMVNDMLQFTPGDCQAFNRTDQCLNARPGVKCVWDIQKSRCLP
AAAVQRERLFDRDQEGLEVCPKKSRLVMTQHELMDYELCSQLTTCQGCVSTAYGCMFCGI
GNGKGICVKEKCPDVSYTYRADFYPTKALKDCPDNDEHVCAQLHGCHACTAVSVCHWDYE
HSRCQYSRNKSGDALNDACPPACSGLTSCGNCTQEECIWCQNEQRCVDKNAYTASFPYGQ
CREWTTGSSKCRAASSGKSQCGFYRTCAQCRDDPACGWCDDGSLTGLGKCLPGGDSGAHE
ESECPAQRWHFTHCPSCQCNGHSTCPDAKTCKQPCSNLTFGPNCDKCKPGFWGNPVNGGI
CQKCECNGQAQYCHSETGKCFCSTKGLAGDHCEKCDATNHYHGDPSRGSCYYDLTIDYQF
TFNLSKKEDRHFTQINFRNSPVKPDIDADFTITCSVAARMNITIRTAGGIEKPLFSAVNC
STFRYRFSKAEHQFGVEDNVTLTTFYVYVYDFQPPLWIQIAFSQYPKLNLQQFFITFSTC
FLLLLVMAAILWKIKQHYDMFRRRQRLFVEMEQMASRPFSQVLVEIESREYNELSPAVEN
ITAAPRKRKKDSPSPIALEPCEGNRAAVLSLLVRLPTGGLQHSPPGQSAGLAVASALVTL
GNPRRSSIEHPKEPKTKRKQSQHPDSCI
Download sequence
Identical sequences 7165.AGAP003506-PA AGAP003506-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]