SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP003579-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP003579-PA
Domain Number 1 Region: 757-859
Classification Level Classification E-value
Superfamily Cadherin-like 9.99e-27
Family Cadherin 0.0012
Further Details:      
 
Domain Number 2 Region: 1087-1193
Classification Level Classification E-value
Superfamily Cadherin-like 1.33e-25
Family Cadherin 0.0006
Further Details:      
 
Domain Number 3 Region: 1189-1311
Classification Level Classification E-value
Superfamily Cadherin-like 8.99e-21
Family Cadherin 0.0015
Further Details:      
 
Domain Number 4 Region: 1302-1414
Classification Level Classification E-value
Superfamily Cadherin-like 2e-19
Family Cadherin 0.0012
Further Details:      
 
Domain Number 5 Region: 981-1084
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-18
Family Cadherin 0.0025
Further Details:      
 
Domain Number 6 Region: 856-991
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-18
Family Cadherin 0.001
Further Details:      
 
Domain Number 7 Region: 1531-1655
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-16
Family Cadherin 0.004
Further Details:      
 
Domain Number 8 Region: 353-466
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000842
Family Cadherin 0.0049
Further Details:      
 
Domain Number 9 Region: 242-360
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000131
Family Cadherin 0.0038
Further Details:      
 
Domain Number 10 Region: 1427-1543
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000286
Family Cadherin 0.0037
Further Details:      
 
Domain Number 11 Region: 462-535
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000685
Family Cadherin 0.0016
Further Details:      
 
Domain Number 12 Region: 653-764
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000157
Family Cadherin 0.0032
Further Details:      
 
Domain Number 13 Region: 128-239
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000314
Family Cadherin 0.0022
Further Details:      
 
Domain Number 14 Region: 25-134
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000143
Family Cadherin 0.0053
Further Details:      
 
Domain Number 15 Region: 613-659
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000671
Family Cadherin 0.0098
Further Details:      
 
Weak hits

Sequence:  AGAP003579-PA
Domain Number - Region: 1659-1723
Classification Level Classification E-value
Superfamily FLJ32549 C-terminal domain-like 0.0863
Family FLJ32549 C-terminal domain-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP003579-PA   Gene: AGAP003579   Transcript: AGAP003579-RA
Sequence length 1955
Comment pep:novel chromosome:AgamP3:2R:40172480:40210191:-1 gene:AGAP003579 transcript:AGAP003579-RA
Sequence
FLIFGSLPFSLSLSLSRRLGHCNLPPVFTQDMNNLALSEQTPVGAVVYKLEGYDPEGGNV
SFGLIGSDNFIADPISGDVQVIKELDREAQDTLSFSVSIRDRVSATGIESENDNIVNVPI
TIIVLDENDNPPEFQNVPYETEVLENALPGTTIFDGILVTDRDTVGENLDVSCIPQPQNP
DACEKFAIEVTDSQQDRLTAAVVLKQPLDYNERMIYQVLLDASDGLYNASAGLEIHVRDV
QNAPPVFQGSLAAVINEDSPIGTLVMVIQARDGDRGQPRKIVYELVTNPMDYFLLDKHTG
ELRTAKPLDKEALPDDTGLIILTVKAREVVDGVPGNDNLTVASTQASITIRDVNDSPPMF
NKTEYFVSLSENTAPGTPLPLEISVRDPDVGENAEFALRLNDVSNVFDVEPKLVTGSSQI
SIRVANGTLDYENPNQRKFIVLLIAEETKTNPKLSSTATLTVAITDANDNRPTFEQDSYS
TTVSETAHPGQLITTITAKDLDSGLYGDQGIRYSLSGTGSELFSVDAITGAISVADCPGS
GVERTAGEIQRVAGQLVRRRRRQIPTRSDLQHEQHQNASARGIEYMTYRIVNSGESNEYH
DVNHPRQSDGPGKAPCLDYETQSVYYLSYRATDDEGRGQTSVVSVRISLLDANDSPPVCE
SPLYRASVDEGATAFEPPLIIRARDPDVVSEINYRIIGNEAVTRHFEIDKRTGQLTISKT
VALDVNHLRSENVFFGVEATDGLYTTLCNVNITIRDVNNHAPQFARENYLTSIEENFPIG
TVVDRLQALDLDTGINAEIRYRIQQGSFDDFAIDNRTGVVSIARKLDYDRRNTYQMEIVA
SDSGTPSLSGTTMLTVSIINSNDKAPYFTPTTQRAEVSEDAPIGTLVHTLVAVDPDVASS
ESLDYAATEPITAVDKNGKEVGEMEDFKDMFMIDRSGKVFVNRRLLRDSFAVIRITVLVT
DTTAPSIQQGEGLLIITITDVNEEPPLFAPPWTPENPHYHYQVVEEQPIGTILTTVQATD
ADSTIAEYRMTESSFFEIHNTTGLVRSIARIDYEATPVIKFNVSVIDTGVPQLTSTAQIT
VEVVNTNDNDPEFEQPEYTLQVRENSPVGTLVGMVRARDADAGLYGQLTYTIVGDHSGNF
VIDPDTGAITVHNASALDRETEQEASLTAIATDRAPEGMRRSTTVPVQIRVLDENDNGPT
FTQQIYHATVAENAALHPPAAILQVMATDPDEGAAGDVKYAILSDNVGGIFRLDANSGIL
YPGASLIGKSGQYRIDIEARDGLGSGPHNDAATIVIEIQSINQHRPVFIMPALYNATVEI
PENLASPDYLVMTVKATDNDSGSNGKVLYYLQVNSVNVQETDEFSINEMSGELRIRRQLD
RKRQSRYELILVARDQGTPAWFETLRFLTVLLVDVNENYPEFPDASNPYKFFITENGARD
VRIGKIQAFLDSPNPSIFYYMLVGNEDGAFYVDKTSGDLYTNRSVDREENDLYVLYVLAS
KQSDLYVSEHERALLSMDQLERNATIAKVWVHVLDVNDNAPVFKRDVYYAGISSKASINE
LVTIVNATDRDLGVNATLDLFIRGSYLYKYGATKTTGSIVPSPFAISKDGRVVTANYMAE
YNQDRFVLEIVAKEIESPEREAVTRVHVWIFNPEQLVRMILSRPPSEVHQDRDEIVSELG
NATQRLIIVDEIRYHVDSLGRIRMDWCDMYFHAVDMTTQMIVPVEEILREIDAKYDFLQD
YNAGFSIMNVVPAYATTVQDEFDLALAALIALLIVLFVGAVSFIVLCCCLKHWSITIPSE
TRRKDALIKKQIIEDLNTTENPLWIEQKLKLYEEQELTMQVFSEPEVAAAQSAAHQQRRD
SYDLSQAGDNTYATIQPRNYGTSNLSTVLGSSLAPPGALSSSGVTSPSATSSSEVADYAT
LRNSRAPSLFEFRGSTFQVQQPGGTDQPDYVTELM
Download sequence
Identical sequences 7165.AGAP003579-PA AGAP003579-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]