SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP003607-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP003607-PA
Domain Number 1 Region: 101-228
Classification Level Classification E-value
Superfamily Cadherin-like 9.71e-19
Family Cadherin 0.0027
Further Details:      
 
Domain Number 2 Region: 209-318
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000186
Family Cadherin 0.0041
Further Details:      
 
Domain Number 3 Region: 434-540
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000121
Family Cadherin 0.02
Further Details:      
 
Domain Number 4 Region: 342-453
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000003
Family Cadherin 0.005
Further Details:      
 
Weak hits

Sequence:  AGAP003607-PA
Domain Number - Region: 50-113
Classification Level Classification E-value
Superfamily Cadherin-like 0.0186
Family Cadherin 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP003607-PA   Gene: AGAP003607   Transcript: AGAP003607-RA
Sequence length 581
Comment pep:novel chromosome:AgamP3:2R:40474605:40476487:1 gene:AGAP003607 transcript:AGAP003607-RA
Sequence
LLDNRCYLDGGGSAVNFFANEDITVGAVVGSLRVLGDPGKDIVLTLREKDSPVYIAPGTK
DLIVAKPLDKEGLIGPSAVFVNVICERKFSDEAGIIIPVNIRVTDVNDNAPMWIGAPYKL
NLSEVTVIGTRILQGIRAHDLDQPGPYSTVEYQTLPGPYSDFVAFVTPLEGTLVLKKYID
YETVQNFTVKIRAQDQGKPPKYSDTYVTIRVLDSDDQNPKFDRDVYYGQLLAGPGDVSIT
PETIRAEDQDRGIRADIRYSIVSSNGSEDELNFEIHPTTGTIRQRRALPPAQAHHSRTIV
VKATQVDNPDRYALTTVILAPPKGSETSLSAMSVQPPVGGAEFVRGTFYVTVREDAAPGT
KVSQLVPGGGGRADEPVRYRIVGSPLAQEQFRVGPGGELMLARSLNYRRTSQYTFAIESS
LPGGERNTSTTVVVDVLPANMWEPRFRKPFYSFAIENPLHAQQLPMLVGRIEAADGDRTD
ELSFVLKGNYSNLFRVDPYGNLWLVSNRTDLPLAMRLLATVTDSGTPQKSATVPVVVKLK
PETASLTSNLLVVNIVVACVLGVLLLGGLVRCVYRRRKRKV
Download sequence
Identical sequences 7165.AGAP003607-PA AGAP003607-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]