SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP004070-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP004070-PA
Domain Number 1 Region: 582-670
Classification Level Classification E-value
Superfamily DEATH domain 9.42e-16
Family DEATH domain, DD 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP004070-PA   Gene: AGAP004070   Transcript: AGAP004070-RA
Sequence length 682
Comment pep:novel chromosome:AgamP3:2R:49464098:49466206:-1 gene:AGAP004070 transcript:AGAP004070-RA
Sequence
WFCCVIFLQESLERAFAANDIEVLKADYDAARASDNDKKTALHQAFRDMLLTKTEDIPAI
ERFISFAVNSCRKDMTVATMPVVLLGDIFDAVTLDRAEQIFTYVENNVAIWKEECFFTAC
KHNLLRMCNDLLRRLSRSQNTVFCGRILLFLAKFFPFSERSGLNIISEFNLENITEYGMD
GNEMAVDQLSGGADPEVDGEPAEENKLKIDYNLYCKFWALQDFFRNPNQCYNKVQWKTFE
THAKSVLSAFCSFKLEEHRASSTSSGPATKPSDVGGSATAAAAANNCPMEEDQIRESGHF
FAKFLTNPKLLSLQLSDSNFRRSVLVQFLILFQYLNSTVKFKAETHVLTQAQSDWLKETE
TQVYQLIEESPPNGKKFANTARHMLLREELWNSWKNEGCKEFKRPEAALEDTSSGRPPAK
RPRKPLGDLIRDATKQGKFYMGNSEITRLWNLCPDNLQACKGTDRNFLPSLETYLENPKE
KQDPSFEWRALRLLARQSPHFFTLFNSPSYKVADYLESVRKKIQKDKLDIKLEHAIQEET
APTNAEQPEAEGEGLVGEEEHEQMDTELLKTEQLTPEDKNTHKTLAVTKAQLSELAPSIG
RDWKKLATKLGYSADEIQYFESEHATVADQCCHLLTLWFDDDMDASLDNLAYILEGLDMI
PAADAVKQMIALLSDKVEEVSE
Download sequence
Identical sequences 7165.AGAP004070-PA AGAP004070-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]