SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP004154-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP004154-PA
Domain Number 1 Region: 385-505
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000126
Family Growth factor receptor domain 0.0077
Further Details:      
 
Domain Number 2 Region: 308-346
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000224
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 3 Region: 619-656
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000041
Family EGF-type module 0.009
Further Details:      
 
Domain Number 4 Region: 735-775
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000116
Family EGF-type module 0.01
Further Details:      
 
Domain Number 5 Region: 698-739
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000495
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 6 Region: 502-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000737
Family EGF-type module 0.015
Further Details:      
 
Domain Number 7 Region: 173-209
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000354
Family EGF-type module 0.022
Further Details:      
 
Domain Number 8 Region: 289-312
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000097
Family EGF-type module 0.032
Further Details:      
 
Weak hits

Sequence:  AGAP004154-PA
Domain Number - Region: 660-696
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000104
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 589-623
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00028
Family EGF-type module 0.067
Further Details:      
 
Domain Number - Region: 211-229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0896
Family EGF-type module 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP004154-PA   Gene: AGAP004154   Transcript: AGAP004154-RA
Sequence length 1223
Comment pep:novel chromosome:AgamP3:2R:50783505:50835383:-1 gene:AGAP004154 transcript:AGAP004154-RA
Sequence
KSFTLILQALDMYNESYSISERLIDETSFSGVILPSHDWNTLDHIGKSARITYRVRVQCA
DNYYNTTCTTFCRPRNDQFGHYTCGKQGNKVCMPGWQGANCEKAICKPGCDQIHGKCDQP
GECECRPGWRGPLCNECMVYPGCRHGYCNGSAWQCICDTNWGGILCDQDLNYCGTHEPCM
HGGTCENTAPDQYRCTCAEGLSGTRCEIVEHPCAPQPCKNGGTCTLTGNDKSAAVASSTV
ASIVVRGMRGISSAGSGSGTLDSKDQAKSGSSSSSAGLPAPSAGGPQPMKDFVCTCAPGW
TGPTCEINIDECADAPCRNGGTCIDLIGKFRCECPPQWTGDTCQTVSSSRPVCDLSSHLS
CSSSNAFFLSVSYHLSLVLSADVDECESNVASGLGPCINAESCRNLPGSFQCTCLEGWGG
PTCAKNLDDCVGKCKNGATCIDLVNDYHCACAVGYTGRDCSTDINECANFPCRNGGECVD
FIGNFKCICPLGFSGTLCEEAKDHCVSSPCIEGQCLNTPGGYYCHCPPGRAGRHCEFPRV
PCEKGGPCANGKCTFVSFFFFWFASPPGCTMPTSNDTAISGGPIVVPIPCSGRGKCESGP
MGTSCVCQSGFTGPFCQHNVNECTSNPCANNGICIDGEGDYSCECQPGWTGKTCTERAIQ
CLPGQCLNGGSCIPSQFGGAPHCRCTLGWGGPFCSEPLDQCQGQPCHNGGTCESGPGWFR
CLCAKGFSGPDCRINVNECSPQPCLGGATCKDGIGGFTCICPVGRRGVRCEILLSDPSSV
CSNTTTNSPYDPLVSSDSLSKPKVGGAAASQAPSDETNCNSCICVNGKPRCSNLWCGLNN
CLNRNQSSGVGSGCESHQVCVPTSQESCLTPPCQPRGDCRTFEPSRRVAPPKIPAPTDCW
PNQATLGTACARISILLELNRLVRGTSVDGLCHLLRLQLGEKLIKNPSFDVSVFIVLLCD
LKAGTNDTIESTPTDPVGGASSLTEAVRLLAEILSRQQGVQNDSFQTDLVEAAPLTSILE
VKVETALVNEGSTGSNYLIAVGFGIAIVALCLGAVVALLWRQKVHSHSGSGTNLSPHLDL
SRGMDEEKSNNLQNEENFRRYANPLKASSSSLRGAMELSLNPAPEINQIAGPSSVHHRSQ
QLYPPCTPDGAEFEKDPDKQKAANRNSHILLHKTQNADIMTKNIVGAIDSQHKDFGKRSI
NDHTASSAAANVSGVAASGTQSV
Download sequence
Identical sequences 7165.AGAP004154-PA AGAP004154-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]