SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP004166-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP004166-PA
Domain Number 1 Region: 1190-1313
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-25
Family Cadherin 0.0025
Further Details:      
 
Domain Number 2 Region: 349-459
Classification Level Classification E-value
Superfamily Cadherin-like 9.28e-20
Family Cadherin 0.0017
Further Details:      
 
Domain Number 3 Region: 115-247
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-18
Family Cadherin 0.0021
Further Details:      
 
Domain Number 4 Region: 1556-1671
Classification Level Classification E-value
Superfamily Cadherin-like 9.03e-18
Family Cadherin 0.0014
Further Details:      
 
Domain Number 5 Region: 1099-1214
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-17
Family Cadherin 0.0093
Further Details:      
 
Domain Number 6 Region: 1304-1427
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000196
Family Cadherin 0.004
Further Details:      
 
Domain Number 7 Region: 461-565
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000014
Family Cadherin 0.0019
Further Details:      
 
Domain Number 8 Region: 1440-1568
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000143
Family Cadherin 0.0054
Further Details:      
 
Domain Number 9 Region: 234-356
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000542
Family Cadherin 0.0028
Further Details:      
 
Domain Number 10 Region: 847-902,947-1000
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000247
Family Cadherin 0.0074
Further Details:      
 
Domain Number 11 Region: 794-872
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000557
Family Cadherin 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP004166-PA   Gene: AGAP004166   Transcript: AGAP004166-RA
Sequence length 1717
Comment pep:novel chromosome:AgamP3:2R:51005977:51012452:-1 gene:AGAP004166 transcript:AGAP004166-RA
Sequence
PACKLYSKSNLRTKSDGVQFLRLKEDFPVGGEIVSLYAYPRNSILIPRTENSSDYEYFKL
KEINSTVVSVILNRSLDGLVDSDDPQSILKFSVFCSGTSATSAKQDNSSFFTITVYIEDI
NDNDPEFINLPYVVTLDESTPIETVVFNRIKAIDRDKPNTPNSDLEYALAAKHMKSGDFP
FRLEGSQRPSLVLQRALDYDAGWRSMSVQIVASDRGNPPRTANATIRVNLRDVDDLPPIF
TRAQYRTRIKESFPLTGKPIHIPLYIEPPIMAFDQDSLNETLVYGIVAGNERQLFWISPE
TGVLFLQKEIDLDSESLPDNTFTLQIEAQQINDPTKSAFARVDIEVIDLNDNVPEFEVDL
YNISIIENLPKGFSILQVNAIDRDQGENAEFYYYLMDEEPKGAFMIDHGSGWIVVRDETF
LDKEQRSSLKMNVHAVERVEQYDRSRNYGKVQVEITLLDTNDNTPEFEQGTLYEFKTHCN
ASIGSKVGQIRALDPDDLGNGKIQYSIKNVRPNLVIPFLLDPDTGDIRVSEALTYGKIAF
FVEARDQPQNPSESRFNVALVTIDIVCQSIEDIEFIGAPYEFWVGADAAIGSSVGQIRTT
FDMVSDEEIFFDLLHSYPEGVPFAIEERSGIVTVIESMEKFDRRCYEFETVVSYLPDSAG
KNVEQLTPEAYNSLEKIIVTNVTIHVIKHNFMLLRGTNATPIEFRVKENKPNTMIGQLKF
QDFQEQCDADEKGLPPLISVRGDKNRADRQVFQLNGGKNRTRYARRFSRDVSRQSNFIRL
GVQYSLVNSYDVADTVRLTNDGKLMTIKGLDREKQDVIRVTIIAEYFYKQRTFAGIYQVV
IVVEDENDNPPTFNQPFFLGVIAENSPIGTEIVLNNPIIISDMDAAGPNSEYELLLSGES
NSFVAQFSNSTLSNYNKTVAHIFRNLQIANIDPGESRLRPDYRPNKQLEPGNASTPHYNI
LFMGPNKLDREEIESLTLKMMATDRDNLMSEVELKILILDVNDCAPVFERIAIFRKSRCE
MIENTSDLELMYLDEIETEVLPEFLDAGLMEMNSRVSYGSVMVNRTADREHLTMRRKLYK
QKVRQRGRNTRAVAKKSQLKFALPENVEVGKVIFKLTANDDDFEKNSKVFYEVVGQTELN
SGERVSYFRIDRNNGELRVANRLPPETDVKLNITAKDVGGLSDMLQVQFRVYDVNDNAPV
FEKQWYTFNVDEGSYPITGKKIGQVRANDEDTGMNGNVTYMLITDGDQKIPFSISPLDGT
IRVSGEIDREMIASYRFRVLASDNNFDLKLSAMVDVEVIVMDRNDNNPEFTAYDDLRSDR
NNIKRLPVYVAYLDVNAKVGTFVKQVMARDSDFRENGNGLVIYSLTGQSDVLQFSIDPKD
GVVTTASKFTPSEAGTRKTYEHLNVTVVASDFGTPPRSSMALLIVNLQGDTLQQHPVEER
PPLFPYKYYEIELRENDPAPRIVLNVTLSKRYANDPFRWEIVGDTFDDQFRIDERNGSLW
LLRPLDREERDSYDVRIRVQKIKRETRNIPSVLYALENPVKRKSHRLFDNEVEIMIKVVD
VNDNAPVFRDNYGPIISVVPDTANYGYAVMKVEATDDDAGSNGEVRYTLLNEPPRLFAID
SLTGQIRLLNSLASFKEKVFGFDVKATDREGADDGKSTIANVFVYVLHAHQEVCLILAGL
PVDIEKQLGMISSSLSTATGYDIRIRALETNTKVDDA
Download sequence
Identical sequences AGAP004166-PA 7165.AGAP004166-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]