SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP004754-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP004754-PA
Domain Number 1 Region: 169-422
Classification Level Classification E-value
Superfamily Caspase-like 4.49e-63
Family Caspase catalytic domain 0.0000292
Further Details:      
 
Domain Number 2 Region: 1-91
Classification Level Classification E-value
Superfamily DEATH domain 0.0000381
Family Caspase recruitment domain, CARD 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP004754-PA   Gene: AGAP004754   Transcript: AGAP004754-RA
Sequence length 430
Comment pep:known chromosome:AgamP3:2L:3063116:3064911:1 gene:AGAP004754 transcript:AGAP004754-RA
Sequence
MNNKDRFLITHNVEKLVNYTNYKQLSFECIQQKMLSPTMVSRIEGIAQDEVTRHKKLFEK
ITKRGPKAFDTLLAICQQAFPTAYLILKPNSNDNQMHSTHNPQRVRSVSCNVAPKVYSLR
SPGDVDDGKNNNFASNALVEESKCILQVYPDILPTTFSVKLSTRPAETHPKVPAYPMKGR
NRGVAFIVNVITFLKKVHPTRNGADIDGRNLISVFQQLGFVVFYYEDITMGDLKELLAQL
KESEHLSCDCFAFYILSHGDHRKGSDYIFLHDNSLLRVEDLLTEFNSVNCKRLVHKPKLF
FISICRGVQSDLGAYRLSTNTERDGMIDPGKPLPSNIATYCDMLVCYATVPGFAAHRDTN
TGSWFVESMCKIWSEHAHDTDVEILMKLVGEYASSYRTEHSALQTICTEQRGFFKQLFLN
PGYYENPVEL
Download sequence
Identical sequences Q7Q2Q0
7165.AGAP004754-PA AGAP004754-PA XP_318061.4.40869 AGAP004754-PA|Caspase

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]