SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP004959-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP004959-PA
Domain Number 1 Region: 176-270
Classification Level Classification E-value
Superfamily DEATH domain 4.97e-18
Family DEATH domain, DD 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP004959-PA   Gene: AGAP004959   Transcript: AGAP004959-RA
Sequence length 282
Comment pep:known chromosome:AgamP3:2L:7194587:7195863:1 gene:AGAP004959 transcript:AGAP004959-RA
Sequence
MVKFSNLIGTLFSKSAASKLETDAAPLPPRRKADAYGDETMAHTNTPAAAAATQNGNFPN
GVQVVPGMENLALVPGGSSQSLEPVAGEHHTATPQTVVNNVQHNTLTAPQTSISNTTGMQ
VFQIRNASNLHIGNSYTFNTAAVVDEGASTSGSLPGAGSAVKWANLRLSNTISQMMQSQD
EVDTELLDTVSRHLGYEWKSFARRLEYSEGQIDAFEADNSTLAEVSRQIYSFMLDWTRND
DDPTLGRLVTLLWNNKHKETVYYIKQVWKKRKEDKNSPERSS
Download sequence
Identical sequences Q5TS00
XP_557597.1.40869 AGAP004959-PA AGAP004959-PA|IMD 7165.AGAP004959-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]