SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP004993-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP004993-PA
Domain Number 1 Region: 3326-3516
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.26e-35
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 2 Region: 2871-3045
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.28e-34
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 3 Region: 3526-3702
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.18e-30
Family Laminin G-like module 0.0004
Further Details:      
 
Domain Number 4 Region: 3053-3223
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.06e-30
Family Laminin G-like module 0.0026
Further Details:      
 
Domain Number 5 Region: 2669-2855
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.37e-29
Family Laminin G-like module 0.004
Further Details:      
 
Domain Number 6 Region: 1462-1512
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000193
Family Laminin-type module 0.0089
Further Details:      
 
Domain Number 7 Region: 542-590
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000335
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 8 Region: 496-544
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family Laminin-type module 0.0097
Further Details:      
 
Domain Number 9 Region: 1914-1967
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000117
Family Laminin-type module 0.0043
Further Details:      
 
Domain Number 10 Region: 1371-1419
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000106
Family Laminin-type module 0.0072
Further Details:      
 
Domain Number 11 Region: 1863-1916
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000012
Family Laminin-type module 0.054
Further Details:      
 
Domain Number 12 Region: 450-498
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000022
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 13 Region: 1806-1858
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000134
Family Laminin-type module 0.0085
Further Details:      
 
Domain Number 14 Region: 2014-2063
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000014
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 15 Region: 733-783
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000279
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 16 Region: 588-635
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000019
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 17 Region: 633-680
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000391
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 18 Region: 275-332
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000067
Family Laminin-type module 0.034
Further Details:      
 
Domain Number 19 Region: 335-391
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000753
Family Laminin-type module 0.04
Further Details:      
 
Domain Number 20 Region: 1510-1558
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000209
Family Laminin-type module 0.0097
Further Details:      
 
Domain Number 21 Region: 405-452
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000243
Family Laminin-type module 0.051
Further Details:      
 
Domain Number 22 Region: 1765-1808
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family Laminin-type module 0.048
Further Details:      
 
Domain Number 23 Region: 678-730
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family Laminin-type module 0.0073
Further Details:      
 
Domain Number 24 Region: 1423-1459
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000586
Family Laminin-type module 0.039
Further Details:      
 
Domain Number 25 Region: 1967-2016
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000725
Family Laminin-type module 0.019
Further Details:      
 
Weak hits

Sequence:  AGAP004993-PA
Domain Number - Region: 786-825
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000126
Family Laminin-type module 0.018
Further Details:      
 
Domain Number - Region: 2061-2109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00053
Family Laminin-type module 0.02
Further Details:      
 
Domain Number - Region: 2534-2648
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00589
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP004993-PA   Gene: AGAP004993   Transcript: AGAP004993-RA
Sequence length 3704
Comment pep:novel chromosome:AgamP3:2L:7592420:7608179:1 gene:AGAP004993 transcript:AGAP004993-RA
Sequence
MGGITALASITVLVVLTIGTARSELTPPYFNLAEGRRIVASATCGVGTDGPELYCKLVGA
NTENDHQNQYSVIQGQVCDVCDPNDPDKSHPPEYAIDGTQNWWQSPPLSRGMKYNEVNLT
IDFDQEFHVAYLFIRMGNSPRPGLWSLEKSSDYGKTWTPWQHFSDSPTDCVTYFGPDSLK
PLQNDDDVICTMDHSKIVPLEGGEIPIRLLNNRPSANNYFNSSTLQEWSRATNVRIRLLR
TKNLLGHLMSVARQDPTVTRRYFYSIKDISIGGRCVCNGHANTCNVLDPRSPRRILACQC
QHNTCGVQCAECCPGFQQKKWRQNTNARPFQCEPCNCHGHSDECIYSEEIDEKGLSLDIH
GNYEGGGVCQNCQHNTKGINCNQCEDKFYRPYGRFWNETDVCQPCDCDHFYSTGNCEEET
GRCECRAEFEPPLCDACSYGHFGYPNCRQCECNLNGTIGYYCEAVNGTCPCKHNFDGPHC
KQCAKEYYGFPDCDPCDCNMHGSVDSVCDEGSGQCQCRPNFAGRLCDSCKDGFYRYPDCT
YCNCDVRGTLDEVCDKNSGTCLCREGYGGPRCDQCIPGYYNYPDCVPCNCSSAGSTSTVC
DITGRCSCLENFGGRQCTACLAGYYQYPECLPCNCDSYGSLAKSCTNDGQCQCKDNFDGK
NCQQCREGFYNFPACEECNCDPAGVIPRFAGCGSVPAGELCQCKERVHGRICDKCRPLYW
NLTASNPHGCQECECFIDGTIGALDTCDTKSGQCACKPSVTGRQCTECKDGTFDLFGSNL
FGCKDCGCDIGGAADNVCNKETGQCRCHPRVSGRTCSYPLTTHYYPTLYQYQFEYEDGYT
QSGAQVRYQFHEDIFPGFSSRGYAVMSSLQNEVINEVRVLKSSVYRLVIRYKNPNPDNVV
ASILITPDNPTEVEQKTKVLFKPTENPEFVTVSDARGEVPSPVVLDPGSYTISIKTEKTV
FLDYFVLLPAAYYEASILTKKIETPCEFNDPNLCRHYQYPSVAPYNPQTEAFIIEDGQSY
KPVEFFKDFEHLHELKEQDLPTLVETQRELYYPVEVPHAGRYVVVIDYITYRNNPEVGIL
HVNLVGDLDQDGSATVYPCTYTTVCRQPVIDRESREKIFFLDPNNRKPILVRSVDESSAT
AIKSVTAIPYEDWSTDYIRPSSVCVMQDGKCVQTSYRTAPDSKKIEFETENEYLVAEEMP
REVSDNNTKLILLNENLQDVTIKAKVQYPNRYVLIVKFFQPDHPAYNVHYRIETERQNYV
GRLGVRHCPANSGCREVLKQDNGYIEFDLEDKIELTILNGGSTRLWVDYVLLVPADQFHN
GLLQEETFDQTNAFIQNCGQDHFYIQTNASDFCKKAVFSLTADYNSGALPCNCDYFGSTS
FECEPFGGQCQCKAHIIGRKCEACKTGFYGFPDCKPCNCPSTAQCHKDTGECVCPDRVTG
EKCDQCVPYTFGFDQIIGCEECNCNPLGVANNNLQCDMESGLCECKSNVVGRKCDRCQYG
FFNFPYCEPCHCDIRGTTFEICDQTDESCFCKKNVQGRECNTCVDGTYNLQASNPDGCTK
CFCFGHTSRCQTAFLRPFNVSMMKDMTVNTIRLSGGKVTITPWVMAEEIMLNETSAEVSL
SSFDNRDPSAGMVYFGMLDHLFDLNNHLSAYGGYLTYKILFTNGLFGSSLIGADVILEGK
QLEVMHQSYRQPSSNQLFSGSVEMVESNFQTADGGPVSREQFMMLLRDLKNIYIRASYWE
NGLATVISDVSLTMAHDDLDQPHLYRELAVENCDCPPGYTGRSCEDCAPGYYRDPNGPYL
GYCIPCECNGHAATCDCNTGICHDCQHYTTGEHCDQCIEGYYGNATRGTPNDCMICACPL
PVESNNFATSCEVSEDGYEIHCACKPGYHGEKCQSCAPGYYGQPQVEGEFCKPCDCSGNI
NAEEPGACDSVSGECLLCLNNTYGRACNLCAPGFYGDAINLKDCQSCICDKTGMDYCDNF
IGTCNCLPNVIGEKCDRCEEDHYGFESGRGCTPCDCGIASNSSQCDDHTGKCACKPGVTG
RQCDRCEPGYWNYSEEGCVPCSCNTDYSRGLGCNALTGQCECLSGVVGEKCDSCPYRWVL
IPDTGCQECDVCHHALLDVTDGLKLDVDPVLQDIKTIADDYYTSQKLKYFDDMVDELEPK
VRSLDPHGVNLNPSRQKVESLEMEVKNLDRRIQYADENAKDISTNSENLLAAASNVLDDC
RLVHINTKNTIDEVMILGENLGSSEITKLDQAFTEAKHYLDNIKQYSTTPESLNSQLENA
TRLLERVEQFGEPVQTQHEKLAKLMHDIGEFDVKLEDLYTWSLKVEKESGITSKLNNQNK
GSVNTKFDTVSAHAKEATENIENSKLLLANSSNIMKDIDITHKELGNVNKELTDLNNAVD
NDLPNSYDEYQQLNPQIERASAHARDLAIEASSLSDKYSDVSANSETALQAATAHSKIVD
AVKEAGDGIRNATLTAQKATDQTEGIDNRAAESDAASRELLSEARRMFTTLQTELEPQSK
QSIDTVDGIKEKNDHSDDMLHSINAALDGIPEESHTDSWENARDQAIEAQAKSHNSLKIL
DPMISDLSKSVYMAEQLPKEVDNTQKDIKQATTQIERLKTMIPNIRQLVEKLDTKQNQVD
SIVSDIGDRLEALKRQIGEARSVANTVKVGMQFHPNTTVELKPPQSLSQMATNSNVSVFF
RTDKPEGFVLYLGNEVKPDAKKSSRDDYMALEIENGYPVLSIDLGNDPEKVISPKYVADD
KWYQAIVERTGNNVKLIIREELDNGTDVFHTKEQVLPGAYNVFNVDQNSKLFIGGYPPEY
NMPQDVKSSEFDGRIEQLQIGGEHVGLWNFIDAQNVYGSPERESLRNEENPSTGFRFSGN
GYVAIDSKPYTFKQQSQLQFQFKAPPETRDGLLFYAGKNKHFISVEMRNGAVVFQFKLGQ
HAQAVTMGSSSAFNDDKWHKISVERDGNIGKLTVDDREVFQQTGSADHQQLHISEALYFG
GYHSRVNHSEVTSKGFDGCIDDVYILGNKVDLSINLKALDVRPGCPMKFSPLVSFPPRQF
GYVSQPGVASVNSLQVNLKFRTTQSDGVLFYTTTYDQSGTLGLALRDGVLVLSSTGMELT
TGDRTYNDGEWHALTAAHDHDRLTLLVDDDDPHFSQYPPQPLYIENGDIYFGGLPKNYVT
ATNAIASNAYFMGCISDITVNGHIVNFATLTDKKSAVLDQCSRELFAAGDVPLYYPNDGK
DPEVFVQSRFDADRDQSGRYDEDEDKDTRTPDYGRQPTTGAPRAPPSAAPAPTSSSVTTP
SSTTTTTTTTTTTTTTRRPRPDEPQPVCRLPVTPDQDVDFDSGYRFGTGQFSHIEFSEVP
LKNKRQYDFSLSFKTEFPEGVLFYVADPRHTDFIALHLRDGKVFHSFNCGSGSANMSSER
RYDDNEWHTVHFTRHNNKGKLVVDSEDESQGESSGTTRTMALQAPMFVGGVSGDNYEEVA
LNLKMDKNVLERNQFVGCINDIEANGRPLAAPSNITRTIPCSTQIETGTFFGNGGGFVKL
YDKFKVGNELTVSMDIRPRAQSGLLMSVHGRKAYFVLEMINGTISLSVNNGDEPFTATYT
PLPEENLCDGQWRTVSAIKSQYVITIKVNDVSSNPAIGDARSPSTDTTRPLFLGGHPHLQ
RIRGFAARVPFQGCIRNVKVRDTVEQITPKMTVGNVQTGVCPTI
Download sequence
Identical sequences Q7PPF9
AGAP004993-PA AGAP004993-PA|hypothetical 7165.AGAP004993-PA XP_315098.3.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]