SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP005093-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP005093-PA
Domain Number 1 Region: 1487-1610
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000228
Family Cadherin 0.0036
Further Details:      
 
Weak hits

Sequence:  AGAP005093-PA
Domain Number - Region: 776-888
Classification Level Classification E-value
Superfamily Cadherin-like 0.00314
Family Cadherin 0.0032
Further Details:      
 
Domain Number - Region: 1188-1252
Classification Level Classification E-value
Superfamily Argininosuccinate synthetase, C-terminal domain 0.0589
Family Argininosuccinate synthetase, C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP005093-PA   Gene: AGAP005093   Transcript: AGAP005093-RA
Sequence length 1908
Comment pep:novel chromosome:AgamP3:2L:9950809:9957070:1 gene:AGAP005093 transcript:AGAP005093-RA
Sequence
MANLITKQTLTKIQPPITVQITAMDEWNPPKTSTARITIVGDPVISFVTPPDFEQSFYKT
VYKVGDTFTPIRIALLANTYDTSVRYEASGEDADYFTITPATDRSSVTVALRSGTQIDTE
KKLLSLTITASRTGTEFVGRTALVVELSHEPKIVPTFEASLYTGTIDRNKVITVESIKLT
PTTSDSSIRVRLSGEDSQYFTLTFANNQATLAPSNMLTDAVLKEKNFFLVTLQAEKIDVG
TGEALVVLTVEKSNTKDPHFEQTLYEGTITETGVLNVPTVRISPDSFVQGLQYDFTGDTT
LVTISPDSTGTFTITANNVTPEKLIGKSYILLSIVAKLEDEETAHTVVIFKVLRTPVVIP
KFTEPFLEGELVLNTLEVRLPNVELVLDTFSADTKVSVVDDRYFFDILEDFPENVFKVYL
RLNVTREMLRDIDRLSLQVEAQNPNSEKSYCFITVDVSRAAPPAFERLVYDGVIDETKQL
VEEIVAKLTSDSAGERITYTLEGEDVTFFSIKEAPTWDNIRIALKSPLTDEEFESRTHFQ
LNLKATNTLLAVDTVVPLIVYVKHSLVKIPKFEKPLYKSRIDTGLKLVPFEQIKLEPGTY
VGMATVTIRNSNSEFFGVQLQEGIVTIQLLKELDAASVSGVKQFEFVIECANPDLMSGFT
TILIDIDRVVAPEFSDRFYNGEVREGVQQITFDKAVALKPQTIVTDTVYELEGVDSALVR
YVVSNDRSLSFFLRDEVSKEQLKARSEITFIVVASNPSNSQPALVPCTVKIIREVKPSFT
RTSFRGKIVEGNTVVDFGSFPIAWEADSVKDTATFIIVDAVPNSYFEVQPSENRLSINIA
LKPDVKWDQVRSYPYYQLILQAANPGSDTAQCTLVIDVESLPTITPTFTKAIYRGSLQEG
TKEVVFSAADTITVQPGTIMPTFQFTAAEGDANLFDVMLVDDNKFKVSLKDSIAPGTIEG
RDMLSFIITINNAYSADDTATIVITIKLDDIISPAFSKLMYSGTILEGTSVLSLQESILL
SGGTYTENTEIGIGGTDATLFTVSRAESALDLRIQADAIDWNELDAKHYLSIYVQATNPG
SDTATSFVVIEIERLQQPQFVQSSSHGYIEAGDRNVRFADGSELRIVTDSMQPGYQWNLA
GDDYQLFDGSLVEDLFKFSLKESAATEQLLGTRTTLNFKVILRNPNGRTIDSTVVVNRRL
YVPQFSKHIYTGSFNADLKLLLTDAIQITQASFASGTVVTILESNVDFLALEQSERSVEL
KLSRAISTVDFQGLQTVRLVLLAKASEDSWSTCSVMLAVPDGTYLKEHLAITPEGRLILD
RPIIPNVYQFLVHATNTAAGKRATANVLLDVLNQFECTEGDKQVAVNQVLFVTHLEEERP
HATIFSTQLSESCTYELISEHPIEDDQQEPYFYIDPETNWLASRSFDRENEKLFQNMDVP
QFKLVLKLKCFDNDDAADQANRRSMVKRSLVNTETINYAPDITIVSIIVDDINDNDPIFI
YPETASGNKVWLGFPEPSLANRLMLSGLIDVVATDADEDLNAKIRYSVAENEHFNVHPET
GSIKPTKDSLRASNIIDLIVYATDRDGAVDGRSSRLEITVHRLDENQIAFITLDAADEAT
VQEFTEQVNRRSNFHLKVLHQSIVPLLEASSSRANVTKAVRQVQNTMSSMRLIVYAINDN
NQLLSTNDIREGIRAVFPNIKSSAIESFGNAVCYGNQTNSSCPEELSDGSSNSGLIASTS
VLGGLLLICMALTIVLYLRYVRPLSKGTDNNPSDIVQLENDFDTTPPSTSPSLSAKKERN
ADDPEMVEDRKISINIAGITMQGSIILKRYGKQKSEDTNVDAGNRLARSLAERLDEEDEY
GAITSGTSGPETTSEPKNVKFNEVVERIEVQEHHSDEEDGSSVYEERL
Download sequence
Identical sequences Q5TST7
AGAP005093-PA XP_558479.3.40869 7165.AGAP005093-PA AGAP005093-PA|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]