SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP005162-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP005162-PA
Domain Number 1 Region: 835-935
Classification Level Classification E-value
Superfamily Cadherin-like 1.11e-16
Family Dystroglycan, N-terminal domain 0.039
Further Details:      
 
Domain Number 2 Region: 603-704
Classification Level Classification E-value
Superfamily Cadherin-like 5.02e-16
Family Dystroglycan, N-terminal domain 0.023
Further Details:      
 
Weak hits

Sequence:  AGAP005162-PA
Domain Number - Region: 406-589
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0235
Family Phase 1 flagellin 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP005162-PA   Gene: AGAP005162   Transcript: AGAP005162-RA
Sequence length 1211
Comment pep:novel chromosome:AgamP3:2L:10820811:10847221:-1 gene:AGAP005162 transcript:AGAP005162-RA
Sequence
MPLPVSAIDRSAPPRDKDSTRKTWLTALEIDRWPGRGFNFVCYTRNVSKSHGFISHSPKS
QAGVRCLPTESTIQLSLILRAKSWKHVQTSLKQRTISKLAEYFLVPEVSCWISMEFQTEQ
GLPLEYLPVPPRWKIDSVGCGEKMSSSAKETVRNVNTQLAELRDLTGMDFGWWIIWKEQT
GGGAASDKRIKREVDPDDDYYDYDDDEAAEDDDEGKTIANNEQLKKDEETLLARKAKHKR
IDIERIVETELLLPEIERLQDEVFRDDYVIEDVVRGPKFYDFSTQPQLDRFVPLEPEPEK
RQPATSPTTTLPASVNRSPTTVKPQYVTVEKTATPPMPTTSKQVPATTPNSKPRTSPTQA
VSTLTVPRRHTDESLFTTKLPHPAITPVVSSIDADEDAPSRSDTTTTIGTINPTAQSRLV
PPTKLDPTTTTTTTTTTLSSTPARSAAKTTTMTTTTATATSTRAKTIPTELIELQTSAAT
MPLTTTTTTTTASATSTTVSEEPTNPTATTTTTPASSASATNTRSTNLFASVPLVKPSTT
PTTVTMPTTTPSTTTTTTTTEAPTTTTTTTTSTTTTTTTTTTEASTTTSTMLTTELDEPT
NLPPIIRNRIPKQAIPAGKVFRYQVPLETFHDNEDGNNLSLELLDARDQPLKPSSWIQFN
EDTKEIYGLPLEKDVSRWPYKLRATDSGNLTVTEKVDIQVQQHKSHRSLNHEISLALRLN
RKFASNVDWHIETARGISVVLGDVTLSNIIVRDIRNSIQDPSLATFVYTNETLPKDRCPE
EKLDELVALLTEEALNDALNPDITVKSVQGQQIAQCTKVTPPKVKPTQSIQRNYAPQTRN
QVDQVNATVGHLLVFKVPVDTFYDPEDGNELKMKLLTTDRNTLDPNHWLQFDSKNQEFYG
VPRTNDIGRKEYLLMAEDREGLTATDALVVVVNPHHKRDYSVLFELTLDISHEQFNTAQV
QRRFIERLAQVFGDASTHYIKIHHIRPIHHTGQVQVSFFNTTLSRQHQRCPQEEIETLRN
ILLHQDSTIRAKVREILGQEFSLQNVSLVPLDNCHGFDTPHHATSEPEKAAPKPISKDDY
LLTFVLPSVIIIVMLLIAAIIACILYKRRLTGKMELGTDEERKSFRSKGIPVIFQDELDE
KPEIGNKSPVILKDEKPPLLPPSYSSTNHDGDNEDVDEYVPPQPVIVGGRESRGKSPVTP
SYRRPPPYVSP
Download sequence
Identical sequences A7UT91
7165.AGAP005162-PA XP_001688514.1.40869 AGAP005162-PA AGAP005162-PA|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]