SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP005162-PB from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP005162-PB
Domain Number 1 Region: 809-909
Classification Level Classification E-value
Superfamily Cadherin-like 1.08e-16
Family Dystroglycan, N-terminal domain 0.039
Further Details:      
 
Domain Number 2 Region: 577-678
Classification Level Classification E-value
Superfamily Cadherin-like 4.87e-16
Family Dystroglycan, N-terminal domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP005162-PB   Gene: AGAP005162   Transcript: AGAP005162-RB
Sequence length 1185
Comment pep:novel chromosome:AgamP3:2L:10820811:10847221:-1 gene:AGAP005162 transcript:AGAP005162-RB
Sequence
MPLPVSAIDRSAPPRDKDSTRKTWLTALEIDRWPGRGFNFVCYTRNVSKSHGFISHSPKS
QAGVRCLPTESTIQLSLILRAKSWKHVQTSLKQRTISKLAEYFLVPEVSCWISMEFQTEQ
GLPLEYLPVPPRWKIDSVGCGEKMSSSAKETVRNVNTQLAELRDLTGMDFGWWIIWKEQT
GGGAASDKRIKREVDPDDDYYDYDDDEAAEDDDEGDDEPAASSSSTIKTIVPEATTEKSS
TISSFSSAVEYSTPSSTTTATATTTIAALPAITSTPASSWHLGMDEDEEASYESKEFFDE
IHSKPSTFANPEMASISSSTTTTTHGSEDQGTSDYTTTTVSYVPLTTTPTTQEELSRYAT
NVDRSPFGRKINDEDITADQEEEDQEEGEDIDEEEEEEDYFSQGVRITVLPPNNLPPLIP
RAEEAEVTVPTSTLTPDGVDNDRVPNPTEQTGDLRLPGMASPATTTNAMPTDDSTAITMT
SSQYQNTRTTTQPTTNSAYYNIPTTTTTTTPSTTPTTVTMPTTTPSTTTTTTTTEAPTTT
TTTTTSTTTTTTTTTTEASTTTSTMLTTELDEPTNLPPIIRNRIPKQAIPAGKVFRYQVP
LETFHDNEDGNNLSLELLDARDQPLKPSSWIQFNEDTKEIYGLPLEKDVSRWPYKLRATD
SGNLTVTEKVDIQVQQHKSHRSLNHEISLALRLNRKFASNVDWHIETARGISVVLGDVTL
SNIIVRDIRNSIQDPSLATFVYTNETLPKDRCPEEKLDELVALLTEEALNDALNPDITVK
SVQGQQIAQCTKVTPPKVKPTQSIQRNYAPQTRNQVDQVNATVGHLLVFKVPVDTFYDPE
DGNELKMKLLTTDRNTLDPNHWLQFDSKNQEFYGVPRTNDIGRKEYLLMAEDREGLTATD
ALVVVVNPHHKRDYSVLFELTLDISHEQFNTAQVQRRFIERLAQVFGDASTHYIKIHHIR
PIHHTGQVQVSFFNTTLSRQHQRCPQEEIETLRNILLHQDSTIRAKVREILGQEFSLQNV
SLVPLDNCHGFDTPHHATSEPEKAAPKPISKDDYLLTFVLPSVIIIVMLLIAAIIACILY
KRRLTGKMELGTDEERKSFRSKGIPVIFQDELDEKPEIGNKSPVILKDEKPPLLPPSYSS
TNHDGDNEDVDEYVPPQPVIVGGRESRGKSPVTPSYRRPPPYVSP
Download sequence
Identical sequences Q7PQ19
AGAP005162-PB AGAP005162-PB|hypothetical XP_314057.4.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]