SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP005252-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP005252-PA
Domain Number 1 Region: 160-304
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 5.36e-27
Family Toll/Interleukin receptor TIR domain 0.0022
Further Details:      
 
Domain Number 2 Region: 25-120
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000135
Family DEATH domain, DD 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP005252-PA   Gene: AGAP005252   Transcript: AGAP005252-RA
Sequence length 462
Comment pep:known chromosome:AgamP3:2L:13194968:13196613:-1 gene:AGAP005252 transcript:AGAP005252-RA
Sequence
MLDNPVKPTEVSVKNRIDLAVVPLEALSSRTRELVAELLNHKRIFTSEDGYFRDWRGVFD
VIGIPKSFLPLVSTNPNPTRCLLDLWQSETHQCKREPNLAELQCVLGCIDRWDILDDTSK
MFERDAEQFLLREQKRAAQRGRETEATESKVSADSDIITRDDTSDHKQQYDAFILFADAD
IEFASKMVDKLEARGLQLCLRDRDILGGSNFEHEVISRLISERCRRVVVIISKAFLASPL
NDFTVTFAQALQIEQKARKVIPCVYDRCELPPHLRYTCRLDYQRSQNLYNFWDKLAESIR
DTPRKVGLEVSGRELPAPQKPPVHSKPVELIGPPQPLPKVVVEQPPLVVKLPRAAEQDSR
TGSLKKSHSFWDIFSNFGHKKDKLNGSTSQLNLNEMATPLPSPKKVGSSPLALIRRDKKQ
PSAASASSAPSACPLDLPPVIKPVKSKKKWYKPGSRKLASAV
Download sequence
Identical sequences Q7Q9F4
AGAP005252-PA AGAP005252-PA|TOLL 7165.AGAP005252-PA XP_314167.4.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]