SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP005526-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP005526-PA
Domain Number 1 Region: 714-828
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-34
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 2 Region: 597-709
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-33
Family Spermadhesin, CUB domain 0.00044
Further Details:      
 
Domain Number 3 Region: 1185-1297
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.5e-33
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 4 Region: 830-946
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.02e-32
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 5 Region: 1069-1179
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.13e-31
Family Spermadhesin, CUB domain 0.0004
Further Details:      
 
Domain Number 6 Region: 1422-1534
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-31
Family Spermadhesin, CUB domain 0.0006
Further Details:      
 
Domain Number 7 Region: 949-1064
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-30
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 8 Region: 1774-1882
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-30
Family Spermadhesin, CUB domain 0.00058
Further Details:      
 
Domain Number 9 Region: 1539-1652
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-30
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 10 Region: 476-593
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-29
Family Spermadhesin, CUB domain 0.0006
Further Details:      
 
Domain Number 11 Region: 1304-1421
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.59e-28
Family Spermadhesin, CUB domain 0.00048
Further Details:      
 
Domain Number 12 Region: 2865-2978
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.22e-23
Family Spermadhesin, CUB domain 0.00096
Further Details:      
 
Domain Number 13 Region: 3614-3734
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-23
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 14 Region: 2980-3100
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-20
Family Spermadhesin, CUB domain 0.00074
Further Details:      
 
Domain Number 15 Region: 1889-1998
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.02e-20
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 16 Region: 2505-2626
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.97e-19
Family Spermadhesin, CUB domain 0.006
Further Details:      
 
Domain Number 17 Region: 3248-3347
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-18
Family Spermadhesin, CUB domain 0.0022
Further Details:      
 
Domain Number 18 Region: 2135-2266
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.03e-17
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 19 Region: 2740-2846
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-16
Family Spermadhesin, CUB domain 0.0025
Further Details:      
 
Domain Number 20 Region: 2384-2502
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-16
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 21 Region: 2027-2131
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000122
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 22 Region: 3357-3418,3448-3493
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000393
Family Spermadhesin, CUB domain 0.006
Further Details:      
 
Domain Number 23 Region: 3104-3211
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000222
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 24 Region: 2276-2371
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000916
Family Spermadhesin, CUB domain 0.0043
Further Details:      
 
Domain Number 25 Region: 3498-3606
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000011
Family Spermadhesin, CUB domain 0.0018
Further Details:      
 
Domain Number 26 Region: 135-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000109
Family EGF-type module 0.01
Further Details:      
 
Domain Number 27 Region: 165-303
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000385
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 28 Region: 1653-1751
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000051
Family Spermadhesin, CUB domain 0.0042
Further Details:      
 
Domain Number 29 Region: 433-476
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000534
Family EGF-type module 0.015
Further Details:      
 
Domain Number 30 Region: 296-346
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000156
Family EGF-type module 0.019
Further Details:      
 
Domain Number 31 Region: 395-429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000466
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP005526-PA   Gene: AGAP005526   Transcript: AGAP005526-RA
Sequence length 3745
Comment pep:novel chromosome:AgamP3:2L:16617187:16634182:-1 gene:AGAP005526 transcript:AGAP005526-RA
Sequence
MTPYNRAKILATNGHIIIESAQDRNITFYMKGSGHLNIGGLSIEQVLRTLSKMMIDGRPS
TDSQPFLPGGSVADQVQLLATYVSGPYGLIKRVETLEQQSSSRNVTQMNPRIGALARRVR
NVETKVALLMSTLQVNRCTSGPCQNGGTCIAQYDSFMCLCPSNWEGQTCTTDVNECALFA
GTDLGCQNGATCKNIHGGYTCMCPDGWRGIHCNTRSQDCATAGADLCGHGTCVQAKDGYR
CICDQGWKTNGLTPACSVDVDECSESKPHCSKDPEVSCINLPGSFVCGPCPAGYSGNGFY
CVDIDECETNNGGCSTSPSVQCINTRGSYRCGNCPAGYTGDGRTCLAHGNRCTQGLCHPM
ARCVDYGSAVPNCICLPGYIGSGFGPNGCYRSSMNPCASAPCRNGGTCTKIDAQNYSCAC
PPGTNPPNCMRTTSPCESNPCQNGGTCVGSSGTRNFLCRCPAGYTGLRCQTPTRTCGGIR
FQMSGTLRYPEFNGTYNHNARCAWLIKTNETQVLNVTFTQFSLENPVSSGECKYDWLQIH
DGRTSAAQIIGRFCGNELPRGGNFQSTHNMLYLWFRSDNATAHDGFQLRWESIDPVCGGT
IAAVSHGLIASPGTPGNYPPNRDCKWYLQAPQGRRLQFTFFTMKIEVHETCGFDYLEITD
GLRDEGTLLAKYCNTSHPPPLITPSNEATVHFHSDESGNDAGFQIHYAVVEGVPGCGGTY
TQREGVISSPLSQTDNVYPNNLNCEYLIKQPVGSRVEIRFSKFHLEQSEACKFDYLEIFD
GPSTEDPSLGKFCGDRMPPLFTSTGNALLLKFHTDWSAPNPGFSLVYKIKCGGTFTDPAV
ELISPSYPQMYPSDQLCDYVIHAPLGKAIVLDFQDFDFEKNSFPKCELDYVELYDGLLPT
NETLLGRYCSTKAPPQTISSKNVLLLRFVSDGSVSGRGFKGNFSFHDVSCGGVLMREDTI
IRSPMIAETGKYQHDAQCEWIIVAPAGHAVQLTWNSFELEVSAWCVYDYVQVFDNSSMAN
SLVGRYCGTEKPPAITSTGNMVTIRFVTDSSSSKDGFSLSFNFIDVEKSCGGNFFATSGI
IRSPGWPKNYPSNKVCEWVITVPMGQQIMLLVHSFKMEKHRICRFDGLTIRNGGTQNAPL
IGNYCGEDNFNGTISFSHQLYLRFYSDSSRNYAGFMIEWDSATTGCGGILTSPRGSIISP
NYPLPYGQNALCTWRISMSQGSAIHIVFTDMDMESHKDCQYDYLVIYDGIDTSGRKLGRF
CSAETDPIVLDTDTNHALIRMRTDETNQRRGFQLKYNILCRRNLTGYGGVIESPNFPNEY
SASMDCRWTIRVPPGNKINLEFSHFDFESITQQTGSNATHQRCPFDYVELQEMGTGDLPV
ARRYCANKPPPIVSMGRSIDLIFHTDSSGEQMGFRAEWSINGCGGLLTKPWGSFTSPNYP
NQYPKETECHWTIRVEPGKRIELAVDDFHMETNDQCRFDGLHIANDANFTQQVTKICHEQ
QEPVHLSSSGSELFVKFYSDSTFTYKGFRANYRTTDAKCGGKITLHEGFISSPNYPSNYP
ANASCQWLIQTDATHTLQLRLKSLAIERSPNCINDSLQVYDGNVASADQLLLTSCGSEPN
VTSVSSTGHEMLVTFKSNEDMEAKGFQAEFMTNCGSRIEVKRPGNILLNKAHKMSSDNCT
WVLIAPEPTQRITLTIAHLSVMDLEGDCFASVTVYDGDSTDGPKRFDGCGHKIPPAIVSN
GNALTVLVSSEDLLLSKIDNLFVEMAYTTIENACGGRLTALMGQFASPNYPNTYPLNVEC
VWKLSASPGNKMSLFFTELDIEPSDDCNGDYLEVRERDENGPLLGDFCGNQVPTNLTEAS
SFWVKFRSNSAGVAKGFRAEYSYDTMSEITGTSGTITSPMYPRSYARADNIAWRITVDIG
SVIAISFNRYAIDRHTDDPLMCDGALRIYDGYDETAASLLTGCGYIKPDPVTSTSNVVYI
LLDHSDVMESSSFSLSWQQKFVSSAVNIPVNNEYFCDGHATIVLNSTDTVQNLTSPGYPN
GYTNGLNCSWIFQSALPLYHPFLVLTFVDLEESSDCLADYIEVFHSSDLATWRSYGRVCT
YFLRVANKFHGSPHLKVDFRTDYYQNRTGFTGSVILRCGGLLTDPNGVITQPNALPLIPP
TPTLIGRPELMDACSWNISVRAGRTIELTFEQLNITSVATPYANKGFVAIMNGIDDHSPL
IGRYSGTELPGPIKTSSNRAFVQYRPSDTGANRFRLVYREVGIECGGDLVLTAQSNSTII
ATPNYPNVPPPHTECFWKVLAPAGELLRVELLSQMLLPRMPGCRSEYVQLREGLTSQAPE
LLHSCTGDLTKRIITRTNALQVKYFNDRVEPNSAIQLRISLAKCGGVQRGSHGTITSKNF
PQPGGYPVPAVCEYYIQEGQYGMMQLTFEDLHLPIKANCSGQDHVRILSILPAPNDTEVE
LGKFCGQEVPKQPILSVVPNVKIVFTANTPNSIFRGFRLNYAVNYSRCSHSLVGESGEFA
SNGYGEPMQPFSFCEWRITVPAGRRVKVEFIDLDIADQAAPYPWFQRLSFYDGLNYQVRI
KAVTSNDKTTPIYSSDNRMMVQYLSKAMTGRRGFRLRYSSDESSLCEGNLDGWQGSINSP
VNVTTAVCTYKRTDPTLSRDPSAEPNVGTLALNFREVYAGPSERMCVDITRSATPIGGTN
VLKKLCVNATNVVVVSPFPNTVINTAQAAYSGVLAFRMDYRVHQCGGVYGSIPNISYPVG
LEPYGRDGLHCAWYVTFPDQTLISVAFERFTLQQPCDQEYLLVYNGPGPSSPLLGRFCKD
SAPPAEGIVTQRHLLFVEYHTVPANGSSGSAGSDFELRLSSKNFGCGGTLHTGSPTFGSA
LKDGKYLPGQECIWLLQANAGQHIGVRFTGRFNLQTSPNCTKDYVELFDQQRNREWVSLG
RVCGKEVPPSFNSSGTVMKVVFRTDESIEGDGFTIQWNSNCGGIFYAEQETNVIVSPNYP
AKYNNMQVCNYTILANTSDAGIEFNFLDFDLEDSVVTSVCSYDNLTVYRKLEYAEPITWE
KVGTYCRKTPPARFRVKDRAAIVFRTDRYIQARGFRFEYRLDTCGANITSSRRIESPEQL
PPDGMYRPALVCRWYIDIPQGQKVTVRFETLEMDHTESCYFDMVEVYRGLEQTPDKRLAL
LCGNLTSHAPAIAISGTRHGMVSFKTESFSTSRAKMTALVLYSPDCDKHITLDERTPSYR
LNVIGSGNDRVQDCQYVFRAPSGYTLRMVFDQFHVGSARNATNCTDDYVELRDGGSVFSM
LLGRFCGNERVNAQSSFGSTLHLRYVTDSALRGTLFDATVTMVPSLCGAMNRNLTGGAVV
TLNTPNFGGSSKYPPNARCLWLLEAAPGKQIEIQFLTMDLQQYDEGGRECKDYIGIRDAT
LKSIIYEGLGDSLIFNGGSSSKASFYHGSRYANAYNIYCGSNYLPSPYVSITNRVYVSFE
SDGQIEGKGVSLRVHESSVCAKNYTALQGRIVQNELQKDQQCTITVQVPHNYTIALYFNM
FYLYNVDCAVHALKAYDGTHESADRLLGEYCNFATPNPVFTTGNVLRLVFPATDRELVSL
QLDATYVATDQGQGCGGELYNYGGVFTSPLYPANNRTRMECLWTVTVPNNLLVALRFEVF
DLGSKSSCATDYLQVLDREEDPKAPKADDGQEKVVRQHCGGESPANYISTGSTIRVRYKK
TQNFAGVGWVIKFMGVEKGVGVNDY
Download sequence
Identical sequences Q7Q737
7165.AGAP005526-PA XP_315526.4.40869 AGAP005526-PA|hypothetical AGAP005526-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]