SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP005918-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP005918-PA
Domain Number 1 Region: 6-136,193-264
Classification Level Classification E-value
Superfamily Cation efflux protein transmembrane domain-like 2.09e-50
Family Cation efflux protein transmembrane domain-like 0.003
Further Details:      
 
Domain Number 2 Region: 277-343
Classification Level Classification E-value
Superfamily Cation efflux protein cytoplasmic domain-like 0.0000275
Family Cation efflux protein cytoplasmic domain-like 0.019
Further Details:      
 
Weak hits

Sequence:  AGAP005918-PA
Domain Number - Region: 365-393
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.0303
Family Blood coagulation inhibitor (disintegrin) 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP005918-PA   Gene: AGAP005918   Transcript: AGAP005918-RA
Sequence length 454
Comment pep:novel chromosome:AgamP3:2L:23658303:23669670:1 gene:AGAP005918 transcript:AGAP005918-RA
Sequence
MAKFSGKKCRLLTVMTLTVFFFFVEIVVGYLTNSMALVADSFHMLGDIAALVISFLSIKM
SPKKWSKNTFGWARAEVLGALVNAVFLVALCFSITIEACKRFIEVEHIHEPELLIAVGVI
GLLVNLLGLCLLHKHGGGGHIGHSHGGGLSQAKQISGGSHGNLGNTDDNENKSFMYQQNG
TAAKKTTHHGHSHDSSQMNMRGAFLHVLSDALGSVVVIISALIVKFTDWKYKLYMDPALS
VLLVALILNSVWPLLRESALILLQTVPTHIQVDAIQRRLLEKVDGVLAVHEFHVWQLAGD
RIIASAHIRCRNLSEYMKIAERVKEFFHNEGIHSTTIQPEFVEIEALNSYSGSDGFSNSL
NGSATQDCCALDCPTTDESSCIKATCCQNNNNIKPVVVIDKGTAGDTNEPSGSSSAYEGD
QPAGLMMAGGSSATDALLPGSGQNALESEDEAEE
Download sequence
Identical sequences Q7Q6C8
AGAP005918-PA|hypothetical XP_315949.4.40869 AGAP005918-PA 7165.AGAP005918-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]