SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP006122-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP006122-PA
Domain Number 1 Region: 125-235
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000002
Family Cadherin 0.0092
Further Details:      
 
Weak hits

Sequence:  AGAP006122-PA
Domain Number - Region: 235-359
Classification Level Classification E-value
Superfamily Nucleoporin domain 0.00863
Family Nucleoporin domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP006122-PA   Gene: AGAP006122   Transcript: AGAP006122-RA
Sequence length 414
Comment pep:novel chromosome:AgamP3:2L:27007062:27008470:1 gene:AGAP006122 transcript:AGAP006122-RA
Sequence
MKMLLFLSVITVCLHLFTTQVSAECYSPSFNFASYTHPELLDLTTPPGSVIASFPVENVR
SATVVQQPSYLETRIVGTDLQFLTTAAFAQYEEREIQTVIILQVSYQCTTTTKNGLYRHN
LKLANNHAPSFLQDAYEAVVPLPLPKHFDVTPFIANGAGIMARDIDLINNAVTFSVTEND
YMLIESHTVPNDPKQFKAILRLKEQVLKMPNKLELTVTATDAGVPQKSTQVSVVIDPDLS
IVYDDPPVFKETFINTTIAKDLLLRVELIPGTETYDVQYSLQGTDAQYFTQTVWENNTGM
DLKVIDLEPIPKAKPILNVVAVAKRSQLQATSCVVLVHIPPESDPEVPTTTVDKVLSVLH
LNEMSEHRDIFPLTIESCTYSIQSQTPGDYFFIEDATIPSLSSKAFDREDKDLF
Download sequence
Identical sequences Q7Q5Z4
7165.AGAP006122-PA AGAP006122-PA|hypothetical XP_316183.3.40869 AGAP006122-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]