SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP006256-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP006256-PA
Domain Number 1 Region: 1289-1397
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-23
Family Cadherin 0.0011
Further Details:      
 
Domain Number 2 Region: 1169-1269
Classification Level Classification E-value
Superfamily Cadherin-like 9.29e-22
Family Cadherin 0.0024
Further Details:      
 
Domain Number 3 Region: 491-599
Classification Level Classification E-value
Superfamily Cadherin-like 3.01e-21
Family Cadherin 0.0041
Further Details:      
 
Domain Number 4 Region: 247-396
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-21
Family Cadherin 0.004
Further Details:      
 
Domain Number 5 Region: 816-960
Classification Level Classification E-value
Superfamily Cadherin-like 6.42e-20
Family Cadherin 0.0041
Further Details:      
 
Domain Number 6 Region: 1058-1181
Classification Level Classification E-value
Superfamily Cadherin-like 6.57e-20
Family Cadherin 0.0011
Further Details:      
 
Domain Number 7 Region: 725-821
Classification Level Classification E-value
Superfamily Cadherin-like 4.84e-18
Family Cadherin 0.002
Further Details:      
 
Domain Number 8 Region: 587-711
Classification Level Classification E-value
Superfamily Cadherin-like 6.02e-18
Family Cadherin 0.004
Further Details:      
 
Domain Number 9 Region: 131-252
Classification Level Classification E-value
Superfamily Cadherin-like 1.14e-17
Family Cadherin 0.0022
Further Details:      
 
Domain Number 10 Region: 1398-1496
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-17
Family Cadherin 0.0024
Further Details:      
 
Domain Number 11 Region: 373-497
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000243
Family Cadherin 0.0068
Further Details:      
 
Domain Number 12 Region: 1516-1639
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000328
Family Cadherin 0.0094
Further Details:      
 
Domain Number 13 Region: 36-112
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000842
Family Cadherin 0.002
Further Details:      
 
Domain Number 14 Region: 963-1064
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000113
Family Cadherin 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP006256-PA   Gene: AGAP006256   Transcript: AGAP006256-RA
Sequence length 1821
Comment pep:novel chromosome:AgamP3:2L:28650212:28663145:-1 gene:AGAP006256 transcript:AGAP006256-RA
Sequence
MMHPRVKLVSLLVLVVLLQQCARAQIINRTPHFIPGSGDMARFSLLENTPVGSVVYQLRG
VDPEGSKLRFSISGPVFSVDRDSGVVRLRQSLDREQQDTVEVIISLTDEGVLGTEPNTVS
LRREIPIRDYNDNPPVFVGRPYSATISEATKPGSNVTVTPDIVATDQDEGANAELTFSCY
QDPAKGADDICDVFTVHTEKIAQGKFGAWIELRRPLDFETRPSYILTIQARDGSPTNSLR
AVASVAITILDVQDQPPIFINAPYSATIPENTIEGTRVLTINATDGDTGSPNPLMLMLEN
EPMGHFKLNYIGHPRSGVAELITTGKPLDREDPIITQNGGAYTFSIRATELINNELPGDS
TTSQITIVLTDVDDHVPEFSQPAYEVSIPENLEQDTPLPGLAIVVTDRDLGPNSHYTLAL
RNLHNSEGVFAVVPTQGEGRTPIVVKVLDSSRLDYDVPSEEAKTFRFQLVASVDGEEKST
ANVTVRLQDANDNSPTFPQASYSLQVRENSPQGFKIADLSATDHDAGMFGQLAYAVKGFG
AEFFRTHPTEGGLYVERQLDYEEQKSYSLALVARDGGGRETNANVFIDVMDENDNHPAFE
ALEYTRTIREGATEFEPQFFVRAVDVDGPTQGGGRVSYAIESENSISGHVFTVDRDSGEI
KITRPVSSMDTDRGQYELLVVATDHGVPPLKNDTRVLVRVGLSGNQRPIFRGHATAGNRD
IPGPPSYRASIPENAPAGYNVTQVSATDPDGLDELLRYKIVGASDNFVINDLTGLITVTR
DARLDRDTNPESYAIVVNAIDAGFPIPETATTTVHVKIQDINDKPPKFTQQSYTAYVSER
SAIDSEVLRVTAKDTDLSARIEYTLVEPITAVTKGGIPLLTTSSYDYRQAFRIDRDDGTI
FVNSTLNYNYAAVITLTVRATDTAAELYPERQFDQTEVTLYVQSFKDTNPLFRNKGWSTV
RPKIEVKVKEEAPVGSVVFRIEADDPVADVPITDFELMMPDVDGIFGLNERTGEIMLLQR
LDYETYNKTTIDFVVKAITSNRKRHSLAYVNVTVENVNDNAPVFERDSYRVTVLESDRYP
HVVTTVSATDQDVVRTEKDTLLGYNVIRYSLFGSHSNLFTIDNQTGEIRIGPGQVLDREK
QSVLKLIVVAEDAPGRPQDAKKATTEVMVDVLDVNDNAPIFGQRSYTAVIPENVLVDTFV
IAITAHDPDEGLGGEVRYDILNEGEANGLLQINPKTGEIKTKAMLTGKGRAEPYELVIRA
QDSGGQLPKQSSLYNDVSFTLYIGDISANDGIPFFIAPQVGQTANVTENATVGAPVFQVI
ASDPDSPATPSGTLRYRIQSDIEDAKSFNINAKTGLITTTRSLDREIKSAYNIIIEVSDM
GEPPQASTVVLRINVLDIDDHEPRFVREVEAQPYELEVLEEQPAGTIVGNVSALDEDVGP
NGAINYIIIDGNELGLFNVTRTEDNQAIIRTKKPLDRETLESVRLTIRCFKLNTVPDPLT
HESYNRHDKSQLQLLIRVLDIDDHAPRFERENQTIGIRHNVPIDTPIANGRAFDEDPTAR
PIVYSIQSINFVPQFYRRDNRTEEYGDVFSLNPDTAEIRTTRSMSNFVDGYFQLMVRAAN
SDEAERISETQMKIFVIRDKSLLRFVFSRPPTEVSGVLDRFTVEMQERLANANLELSVFD
AQVLSQPDHSLDFSSTSSCFQLTRHGSALTPVEMMRIMDDAEMKETLAEVYHRYSVHKID
SCAVSKKPPATALIASSGTWLVILAGLIGFAAFASTMTACCLAKRYKNQVRSTINSQRIV
GSDIYGSATPVLYTEPIYGAL
Download sequence
Identical sequences Q7PPB2
7165.AGAP006256-PA AGAP006256-PA|hypothetical AGAP006256-PA XP_316322.4.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]