SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP006513-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP006513-PA
Domain Number 1 Region: 378-556
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.31e-28
Family Laminin G-like module 0.0082
Further Details:      
 
Domain Number 2 Region: 997-1181
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.08e-25
Family Laminin G-like module 0.014
Further Details:      
 
Domain Number 3 Region: 1176-1198,1246-1418
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.39e-18
Family Laminin G-like module 0.032
Further Details:      
 
Domain Number 4 Region: 157-353
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.04e-18
Family Laminin G-like module 0.012
Further Details:      
 
Domain Number 5 Region: 1456-1626
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.94e-16
Family Laminin G-like module 0.039
Further Details:      
 
Domain Number 6 Region: 582-758
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.77e-16
Family Laminin G-like module 0.04
Further Details:      
 
Domain Number 7 Region: 41-95
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000397
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0027
Further Details:      
 
Weak hits

Sequence:  AGAP006513-PA
Domain Number - Region: 786-852
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000792
Family Fibrinogen C-terminal domain-like 0.0051
Further Details:      
 
Domain Number - Region: 755-795
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00204
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP006513-PA   Gene: AGAP006513   Transcript: AGAP006513-RA
Sequence length 1628
Comment pep:novel chromosome:AgamP3:2L:33297395:33314570:-1 gene:AGAP006513 transcript:AGAP006513-RA
Sequence
MTYHAASVLLTLCLTLAPIPYDRCVLAIPTNAEPPKEIVYPKCTGPGEPGQCQTFDYRYR
FEQTINNCTQFIWGGCGGNLQNNFETYEQCMQQCANETQTPQPPVPLTTTVDPSSTSVRT
QTQEAWSLHSSSSTLAPVPDELRGSELTFKETGYEKTFMFAKNNTFIQMDGETIQTFQLR
LCREISFQFRTRLPHGLLVYHNVKTPAGVKLDPYALYVIVEKGQLKVVHVFGNHSTSVTV
GEGLNRDEWHSVMVRIDVHGARLIARVDNNKEEVYLKGLNHETNYGVSINLMSVVLVGGL
SSEEKLHGVKYIIESFVGCIRNVVLSSGKAASDLLPITPLIATKHENVKEGCRNKCHSRQ
NLCFTGSRCINHYYDISCDCFGTKYEGEHCDIYTATVLTLRGSSYVSYRIYDWKDRVHSP
ITRISMMFKTNYDDSALFYASGESLKPQYIAASIKNHSAYIEMDFGDGVMSATLGQDLTR
HYWHNLTILHEHDKVIAILDDHVRILDLLGPIHNLLFDPEIYFGGGPNLSKRKGLASSNN
FVGSLKYVFYNDVSVLFELKKGNPKVHYIGVLQEEFYEANVEVIPITFSYAKSHIWWPMN
NPDTLSLKFDFKSSKATAVLAYSEVKTSEGNGFWELRLATDRLSFDLCPDVKSNITHTTY
IRIENPTSWHSIQLTYERNDIKFVVDYRHSVTQMYGLSFNIGDKLIIGSSLKAAASGLVG
CLRDLKINGVEIEPRYLVKSERVVGDVSLDNCKYVDPCKKPNTCEHGGKCAVKDDGIICD
CKDTGYIGKNCHFTKFRKTCEELALLGYSKSDVYSIDIDGNGVFPPARVKCDFQSLANAT
KTIVEHNLPSQVDVRSATDEDFSFNIQYREFSAEMLQELISHSLYCTQYIKYDCIKAPLE
LHSSTWFKSSSNNNTVDSLGEVKRGTCPCAIGKNCEDLNHSCNCDANLNRWLSDEGYYKE
PPNLGITQMYFLQQKNLDEESQGRVTLGPLECVETNTQKYVVTFTTSQSYIEVPGWRKGD
IAFSFRTTGEKAILLFQPPIRSNYPSFMVALTGDYQLTFNFTLNTGTPKTLVIDTNRKLN
GGEWHKIWIDYNEHHVRFMINTDTRMVDLQPEEEFGPFEGSMFIGGAPTEISKKYTVKQG
LIGCFRGLVVNGEILDIYSFMSVHLSEIIKDCKPSCVPNPCKNGAYCRELWSTFECVCQN
RWAHLGQHCETNINEDALTFISRESYLKRNYLSDPEDMRDEREKLRAILNSSLLVNLRTY
DRHAFVLYANDHYNNFIHLYLTDQSEMVYLYNYGSDIVNLTIEHSELNNARSIQVAVIRT
ETNTTLYVNEKNVTVERGFLLLDEYSNKPWTNPELEVLSPHRPPAPPTEYFQFNIGGYDP
ANLLRPNQDTTELEGYIGCIRGLKIGENLISLREMATQNNAHVTDGVLNGCQMKCDAEPC
KNGGICTENFVRQESTCNCEHTSFLGEFCSEEKGASFSGEATLLRRLALADTVGSVRLQL
AFSSNDMRRANRVMLLLQSRNDRSYYLMVAITAENHLYIEEDREGATYAARIEGNFMDDA
RHSVYYTRHGDEASLLVDRAQIPIRAVANKPLVPVPDPGANHVQIGGVNTTDPRFAVYKS
YDGCLSSE
Download sequence
Identical sequences Q7Q5D1
AGAP006513-PA|hypothetical XP_316540.4.40869 AGAP006513-PA 7165.AGAP006513-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]