SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP006731-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP006731-PA
Domain Number 1 Region: 926-1042
Classification Level Classification E-value
Superfamily Cadherin-like 4.57e-23
Family Cadherin 0.0011
Further Details:      
 
Domain Number 2 Region: 2214-2329
Classification Level Classification E-value
Superfamily Cadherin-like 7.28e-23
Family Cadherin 0.0011
Further Details:      
 
Domain Number 3 Region: 2811-3011
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.72e-23
Family Laminin G-like module 0.041
Further Details:      
 
Domain Number 4 Region: 1576-1691
Classification Level Classification E-value
Superfamily Cadherin-like 1.26e-20
Family Cadherin 0.0014
Further Details:      
 
Domain Number 5 Region: 125-238
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-20
Family Cadherin 0.0013
Further Details:      
 
Domain Number 6 Region: 20-129
Classification Level Classification E-value
Superfamily Cadherin-like 6.57e-18
Family Cadherin 0.0014
Further Details:      
 
Domain Number 7 Region: 2109-2218
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-16
Family Cadherin 0.0022
Further Details:      
 
Domain Number 8 Region: 1471-1580
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-16
Family Cadherin 0.0021
Further Details:      
 
Domain Number 9 Region: 821-930
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000126
Family Cadherin 0.0026
Further Details:      
 
Domain Number 10 Region: 2315-2442
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000385
Family Cadherin 0.0052
Further Details:      
 
Domain Number 11 Region: 1677-1804
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000571
Family Cadherin 0.0048
Further Details:      
 
Domain Number 12 Region: 242-353
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000143
Family Cadherin 0.0064
Further Details:      
 
Domain Number 13 Region: 2428-2532
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000143
Family Cadherin 0.0021
Further Details:      
 
Domain Number 14 Region: 1790-1894
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000143
Family Cadherin 0.0021
Further Details:      
 
Domain Number 15 Region: 339-443
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000143
Family Cadherin 0.0021
Further Details:      
 
Domain Number 16 Region: 1140-1244
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000414
Family Cadherin 0.0022
Further Details:      
 
Domain Number 17 Region: 1043-1149
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000642
Family Cadherin 0.0076
Further Details:      
 
Domain Number 18 Region: 721-801
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000141
Family Legume lectins 0.041
Further Details:      
 
Domain Number 19 Region: 1896-2001
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000314
Family Cadherin 0.0074
Further Details:      
 
Domain Number 20 Region: 2049-2115
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000811
Family Cadherin 0.0079
Further Details:      
 
Domain Number 21 Region: 2534-2639
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000871
Family Cadherin 0.0074
Further Details:      
 
Domain Number 22 Region: 1404-1477
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000928
Family Cadherin 0.0096
Further Details:      
 
Domain Number 23 Region: 445-550
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000003
Family Cadherin 0.0074
Further Details:      
 
Domain Number 24 Region: 1246-1351
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000003
Family Cadherin 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP006731-PA   Gene: AGAP006731   Transcript: AGAP006731-RA
Sequence length 3100
Comment pep:novel chromosome:AgamP3:2L:37315119:37386224:-1 gene:AGAP006731 transcript:AGAP006731-RA
Sequence
MNFRGLKADATMLVKVLDENDNIPEFIGDSNGVILEHEPVGTFVMQVKAHDNDGTSANNI
VSYRLEGTARQYFHIDSKTGNITSLMEFDREAKDTYPVTVVAEDNSPSVLFNNGKPNSAV
KQLFIRVLDKRDHPPQFEEQYYEVNNIPKDADTNTSVIKVKATDLDKDPKIKYSIIENNI
GKAFKIDEDTGLISVNKKLDYESIQEYDLVVKALDGLCKSTANVRIQIKNLNDNASQILT
LTNVTIKENTIPLDCIANLWAYDPDIKNFEYPQNIQYALPKEHQHLLSIDDKGCLKLLQP
LDRDPPHGHEVLQINITITDENGKERTAMETVYIFVEDINDNAPQLTNRMPVVWSENRPS
AMITKLTAEDADGEHNGPPFFYSVDPDAPTEIKNRFQTVGDELYSLVEFDREQQKQYLVP
ILIRDSGHKPMSAVSKLLVVIGDKNDNEMQMGQSHILVNNYEGKLADTQIGRVYVSDPDD
CDVSDKMFLWDEMTPETNRKLFKLNINTGAITMRKGTPEGIYNLAFTVIEESSYFPRHNV
SARVTVTVKNILAKTVNQSGSIRFYNVTAETFISQTLGELNTPMYRLQQSIAGILVTSPD
QVDIFTINNRKLSRGAFLDLFFAVHDTIYTSSEVLNAVLSLHLRQLEEDVGYRIVTVGID
DCLEKGHTCTQTCKNKVLKTAKPIVVHTNTSSFVGMTTLVQAECIPQIESSLVTCLNGGT
FQNGKCKCPTGFEGPQCEKLDICFDGSGYAIYPSINSGNVNNISIELLPRQKDGLVFYMG
PLKYDPSLKASPFLALEINDAMNVKGLKAEAAVLIKVLDENDNIPEITGNLNGVILEHEP
ADTFVMQVKAHDNDGTSAHNIVSYRLEGTARQYFHIDSKTGNITSLVEFDREAKDIYPVT
VVAEDNSPSVLFNNGKPNSTVKQLFIRVLDKNDHPPRFEEQYYEVNNIPEDADINTSVIK
VKATDLDKDPKIQYSIIENNIGKAFKIDEDTGLISVNKKLDYESIQEYDLVVQAHDGLFK
STTNVRIQIKNLNDIAPQILTLTNVTIKENTIPLDCIANLWAYDPDIKNFEYPQNIQYAL
PKEHQHLLSIDDKGCLKLLQPLDRDPPHGHEVLQINITITDENGKGRTAMETVYIFVEDI
NDNAPQLTNGMPVLWSENRPSAMITKLTAEDADGEHNGPPFFYSVDPDAPTEIKNRFQTV
GDELYSLVEFDREQQKQYLVPILILDSGHKPMSAVSKLLVVIGDKNDNEMQMGQSHILVN
NYEGKLADTQIGRVYVSDPDDCDVSDKMFLWDEMTPETNRKLFKLNINTGAITMRKGTPE
GIYNLAFTVIEESSYFPRHNVSARVTVTVKNISAKTVNQSGSIRFYNVKAETFISQTLSE
LNTPLYRLQQSIASILDTSPDQVDIFTINNRKLARGAFLDVFFAVNNTAYIKLGGKLDYE
KVQEYRITVRAMNVKGLKAEAVVLIKILDENDNIPEITGNLNGVILEHEAVGTFVMQVKA
HDNDGTSAHNIVSYRLEGTARQYFHIDSETGKITSLVEFDREAKDIYPVTVVAEDNSPSV
LFNNGKPNSAVKQLFIRVLDKNDHPPRFEEQYYEVNNIPEDADINTSVIKVKTTDLDKDP
KIKYSIIENNIGKAYKIDEDTGLISVNKKLDYESIQEYDLVVQAHDGLFKSTTNVRIEIK
NLNDIAPQILTLTNVTIKENTIPSDCIANLWAYDPDIENFEYPQNIQYALPEEHQHLLSI
DDKGCLKLLQPLDRDPPHGHEVLQIDITITDENGKGRTAMETVYIFVEDINDNAPQLTNR
MPVVWSENRPSAMITKLTAEDADGEHNGPPFFYSVDPDAPTEIKNRFQTVGDELYSLVEF
DREQQKQYLVPILIRDSGHKPMSAVSKLLVVIGDKNDNEMQMGQSHILVNNYEGKFADTQ
IGRVYVSDPDDWDVSDKMFLWDEMTPETNRKLFKLNINTGIITMRKGTPEGIYNLEFTVI
EESSYFPRHNVSARVTVTVKNISAKAVNQSGSIRFYNVTAEKFISQTLSELYTPMYRLQQ
SIASILDTSPDQVDIFTINNQQVNNTAYIKLGGKLDYEKVQEYRITVRAMNVKGLKAEAV
VLIKVLDENDNIPEITGNLNGVILEHEPVGTFVMQVKAHDNDGTSAHNIVSYRLEGTARQ
YFHIDSKTGNITSLVEFDREAKDIYPVTVVAEDNSPSVLFNNGKPNSAVKQLFIRVLDKN
DHPPQFDEQYYEVNSIPEDADINTSVIKVKATDLDKDPKIKYSIIENNIGKAFKIDEDTG
LISVNKKLDYESIQEYDLVVQAHDGLFKSTTNVRIQIKNLNDIAPQILTLTNVTIKENTI
PSDCIANLWAYDPDIENFEYPQNIQYALPKEHQHLLSIDDKGCLKLLHPLDRDPPHGHKM
LQINITITDENGKGRTAMETVYIFVEDINDNAPQLTNRMPVVWSENRPSAMITKLTAEDA
DGEHNGPPFFYSVDPDAPTEIKNRFQTVGDELYSLVEFDREQQKQYLVPILIRDSGHKPM
SAVSKLLVVIGDKNDNEMQRGQSHILVNNYEGKLADTQIGRVYVSDPDDWDVSDKMFLWD
EMTPETNRKLFKLNINTGMITMIKGTPEGIYNLEFTVIEESSYFPRHNVSARVTVTVKNI
SAKTVNQSASIRFYNVTAETFISQTLSELYTPMYRLQQSIASILDTSPDQVDIFTINNRK
LARGAFLDVFFAVDDTIYTSSEVLNAVLSLYLRQLEEDVGYRIVTVGIDECIEKGHTCTQ
TCKNKVLKTAKPIVVHTNTSSFVGMTTLVQAECIPQIESSLVACLNGGTFQNDKCKCPTG
FEGPQCEKLDICFDGSGYAIYPSINSGNVNNISIELLPRQKDGLVFYMGPLKYDPSLKAP
PFLALEINDGMLVLLLDYGTGTSRFEHQQIVLHEIIKVQVILQPYRIEIKTVNNKMVSSR
SHYENKDWSGFLPGNVSFQLGVSSISLDKLGSLYSWKYVPFTKSFDGCLRNLTINGRTID
FTQTSHKHNVLFNSQGFTAIGKQRFLVWIVILSLAIMVMSILIAIRLKDYLKTWIKILIR
KLQTESMNMMVELHPAPEQLPSFTEVDERSVGLLSGVSTH
Download sequence
Identical sequences A7US09
7165.AGAP006731-PA AGAP006731-PA XP_001688153.1.40869 AGAP006731-PA|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]