SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP006732-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP006732-PA
Domain Number 1 Region: 993-1193
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.51e-21
Family Laminin G-like module 0.048
Further Details:      
 
Domain Number 2 Region: 393-501
Classification Level Classification E-value
Superfamily Cadherin-like 3e-20
Family Cadherin 0.0014
Further Details:      
 
Domain Number 3 Region: 138-245
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-20
Family Cadherin 0.0013
Further Details:      
 
Domain Number 4 Region: 298-393
Classification Level Classification E-value
Superfamily Cadherin-like 7.14e-17
Family Cadherin 0.0013
Further Details:      
 
Domain Number 5 Region: 33-137
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-16
Family Cadherin 0.00083
Further Details:      
 
Domain Number 6 Region: 536-620
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000012
Family Cadherin 0.0066
Further Details:      
 
Domain Number 7 Region: 613-689
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000685
Family Cadherin 0.0033
Further Details:      
 
Domain Number 8 Region: 723-822
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000428
Family Cadherin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP006732-PA   Gene: AGAP006732   Transcript: AGAP006732-RA
Sequence length 1267
Comment pep:novel chromosome:AgamP3:2L:37327355:37369168:1 gene:AGAP006732 transcript:AGAP006732-RA
Sequence
MTRRIGFVLLLISSNWIHCHCFAAADIKASINHKPSFHNCGEYKPTFKEEQEPGTSVLRV
TATDPDQSQTIKYSIANETRQEQLFAIDEDTGEISSAYIFDRDPPYRDTEFYITVRATDN
GQPSLDDVCTIKLMILDINDNPPVFDKDFYEVFVSMNTTLRQQVTIITAKDIDDETNNVV
NFEIVQEYKDDSYFEIDQHTGVLTLAKRIDRNPGEYYALRVRAYNQGCIENESDSPEVDV
KIHIINADKRLPYFTKVPEAPVILHENFTAFQQVLAVFEANSNINNESTIIFEIFRDYKP
TLQEENEPGTSVIRVTATDPDQSQTIKYSIANETRQQQLFAIDEDTGEIFSAYIFDRDPP
YRDTEFYITVRATDNGQPYLDDVCTIKVKILDINDNPPVFDKDYYEAFVSMNTTLHQQVA
IITAKDIDDETNNVVNFEIVQEYKDGSYFEIDQHTGVLTLAKRIDRNPGEYYALRVRAYN
QGYIEHESENLEVDVKVHIIDADKRLPYFTKVPEVPVILHENFTAFDQVLAVFEANSNIN
NDSNVIFEIVRGTFEQTNSMNTFLLEQIENTAHIKLARALDYESVTEYTITVIATNRHNL
AAEAVVKIMILDVNDNVPVIIKDVSCVQYELIDNSPVFQIHAYDLDGTSANNIISYSIAE
SNQQHFTIDSHTGTVTKQNRLYNDEKDIHNAITNIPAQEQRSSNDNTFQNVLSISNDYQN
RDFFNRRYIMVNNYEGMLTDKLIGSIYVDYDIKDNSNKLFLWDERASTGTRKHFTLNYKT
GMMMMVKSTPEGIYNLEFTVIEESSCFPRHNVSAYVTVKVKNISAKTVNQSGSIRFYNVT
AETFISQTLSELNTPLYRLQQSIASILDTSPDQVDIFTINNRKLAGGSFLDVFFAVDDTI
YTSSEVLNAVLSLHLRKLEEDVGYRIVSVGIDECIAKGHMCKQACKNKVHRSQKPIVVHT
NTSSFVGMTTLVQAQCIPQIESSLVACLNGGTCQNGKCNCPMGFEGPQCEKLDICFDGIG
YAIYPSINSGNVNNISIELLPRQKDGLVFYMGPLKYDPSLKTPPFLALEINDGMLVLLLD
YGTGMIRFEHQQLILHTVTTVDIVLEPHRFEIHTASNKLKGSSRSRYENKDLSGFLPGNM
PILLGGTVNHFAKYLLYNWPLHLLGTPETLDFNGCMRNLTINGHTIDFMLPMVANNVSFS
YLWSDSVHISPNRFMFSLMIFAFLIVIIAIFSSRNKIIYWMKYNLERCYQYSMNETETNR
MKPLISI
Download sequence
Identical sequences Q7PT75
AGAP006732-PA 7165.AGAP006732-PA XP_309012.4.40869 AGAP006732-PA|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]