SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP006747-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP006747-PA
Domain Number 1 Region: 187-398
Classification Level Classification E-value
Superfamily p53-like transcription factors 6.53e-59
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00013
Further Details:      
 
Domain Number 2 Region: 746-961
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.24e-42
Family Ankyrin repeat 0.00019
Further Details:      
 
Domain Number 3 Region: 393-501
Classification Level Classification E-value
Superfamily E set domains 1.21e-35
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00012
Further Details:      
 
Domain Number 4 Region: 1047-1126
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000141
Family DEATH domain, DD 0.02
Further Details:      
 
Weak hits

Sequence:  AGAP006747-PA
Domain Number - Region: 118-170
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000314
Family beta-sandwich domain of Sec23/24 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP006747-PA   Gene: AGAP006747   Transcript: AGAP006747-RA
Sequence length 1132
Comment pep:known chromosome:AgamP3:2L:37733113:37744769:-1 gene:AGAP006747 transcript:AGAP006747-RA
Sequence
MSTLLNLDSYRHELYEQQQLLGTSPIQYTVLSMDTPSPSSSSAAAAVVSVGEFTLGPGRT
YASALSPSSSSASPSSPSSVASPNSRASNMSPESSASDQSAAYTLQNLNLSSSAGTMNYP
GMGYQQQQQQQQQQQQHHQHQQLQQQQHHYYTPQLLNLDQEQLQTQTFTYVTSSNEAFAA
PEPNYSEPHLVILEQPVDKFRFRYQSEMHGTHGSLMGSRTEKSKKTFPTVELRGYGGEAK
VRCSLYQVDPQRRAPHSHHLVIKSGELDLIDPHDLDVGGAAGAAEPSEGVGGDGKYVATF
QGMGIIHTAKKFIAEELYKKLRKHRLCELNREPTEREEQQMQKEAAVMARTMNLNQVCLC
FRAYRVEPGTGRWVPICEPVYSNPINNMKSALTGELKICRLSTTVSGVDGGEEVFMFVEK
VCKNNIKIRFYELDEYDQEVWQEMAIFSEADVHHQYAIAFKTPPYRHKDITEPVEVLMQL
FRPRDRCQSEPVLFKYKPRPGMMVVPGAGASGASRKRLRISSGNVSSEIPTVIQNDPNGP
VGPAGVGGGGGGGGGGGGGGVIGSGSTTRLPPLHQPFPMLANHAGGGAIPEGQEPTSTTS
LTTSAHHPDIMSGIGSTTTISKELTKASIIQEILNIPTTIASDVAFDSSDFPCNSEEFNK
LIQEIGNQQDLVKLETDAETAGGGATDTESVLGRAIADLVASGDDSRQGEMLRKLLALIK
LFAGDVNRSRQLLASHWTAANQQQLNCLHAAIRRNDTTIACKLIELLHEYQLAEELLDLP
NDRNETGLHLAVSCNSEPIVKALLGAGAKLHYCDYRGNTPLHRAVVENVPDMVRLLLLQG
GLRLDCTNDDGLTALQAAVYARNLKITRILLEAGASVREKDLKHGNNILHIAVDNDALDI
VHYILEEVKEELGRERNNAGYTPLQLADAKSHTGQGNNKLIVRELLRHYPDGLQKEVKKE
VDAAEDDEEEEEEEQEEEEDEDEEGGEEHGQREASAPSSSVLDSMDLINGERASIARLLE
EHEPEAEPQRKATKRSDSGPDRTEPDTLLDEQCLEELCRLLDAGSGWRELGSLLDFHSFF
TVWEQAPSPARMLLGYFEMQQLHLDRLIDMLRVLELRDPIRSIDEMICRRMK
Download sequence
Identical sequences Q7PT80
XP_308995.3.40869 AGAP006747-PA|IMD AGAP006747-PA 7165.AGAP006747-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]