SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP007023-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP007023-PA
Domain Number 1 Region: 33-149,186-315
Classification Level Classification E-value
Superfamily YWTD domain 4.71e-24
Family YWTD domain 0.0009
Further Details:      
 
Domain Number 2 Region: 518-561
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000282
Family EGF-type module 0.023
Further Details:      
 
Domain Number 3 Region: 481-515
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000457
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  AGAP007023-PA
Domain Number - Region: 400-433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00061
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 370-400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00686
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 437-479
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0335
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP007023-PA   Gene: AGAP007023   Transcript: AGAP007023-RA
Sequence length 704
Comment pep:novel chromosome:AgamP3:2L:41013267:41025452:-1 gene:AGAP007023 transcript:AGAP007023-RA
Sequence
MKSPCRAAAGWLVLLLSSCCLGYVIATEWAAAVTTDNGILFFDSNWRKISSAAHQYSRIS
AFAYDEVLGKLYFADLDHPEYRLFALDYDDTDELHKVTKLLPKSAQTAYISGMAFDHLER
RLYWTEKGTRSVYYVAIDELLSSTRSAAAAANGTAAAAATAVEATTSAPPPSSSSPVQLV
ATVQPDHELAGLAIDECRRHLYWTNCYPKTSNIVRAAMNGTVLNVHEEQVYLPKGITVDH
YRNRLYWVEKKYGRRYTIESADLEVNDQRTLQTGLDRLPADIAVKNDYIYWTDQENNEIY
EMSKEPNAPSRTVYRGEHPSAVILRANLLLEHQRNNPDCRSVVDRILENMQNSKPASVLQ
QETQQQGQLTVCLNNGTVNHHTNTCLCQPAFGGKLCEIDLCNNYCAQGSCRIGRDNRPRC
DCDRRYEGDRCDRNRCDGFCLNGGRCQFSNGTAGRTEEEMGDRTCLCESTGYSGARCENP
ICGTDYCYNGECYVEEGKRPKCRCKAGYRGERCEEYSCNNYCLNGGHCTLGNETTVPECE
CGEEFAGQRCEIAVRLCSTYNEDPQWQQYCLGISKTLPLMEPKVTYCKESFNRTVVYTSL
CFTVSFALLLAVVLVVSRMMKPPRPRITKKMVVTPMTSRPPTTQCEITIENCCNMNVCET
PCFDTKLLKKSKKEDKQFLLEDIEDVGGSYRKLPNCGDGTAERK
Download sequence
Identical sequences Q7QIQ6
AGAP007023-PA AGAP007023-PA|Protein 7165.AGAP007023-PA XP_308749.4.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]