SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP007103-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP007103-PA
Domain Number 1 Region: 326-545
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-22
Family Glycosyl hydrolases family 16 0.077
Further Details:      
 
Domain Number 2 Region: 139-238
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000228
Family Cadherin 0.0034
Further Details:      
 
Domain Number 3 Region: 46-146
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000131
Family Cadherin 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP007103-PA   Gene: AGAP007103   Transcript: AGAP007103-RA
Sequence length 1020
Comment pep:novel chromosome:AgamP3:2L:42690394:42780336:1 gene:AGAP007103 transcript:AGAP007103-RA
Sequence
MVPAKGFLLTLLVVLVASSSFSSHHQVKGEKYEDEDDYYDSRERVLENSYHGLIKENETF
VEITPLIKVDETKICGFHIIKKNKEIPFQIELVNELGILKAKKTLNCEKRKNYKFDITAV
FCDGSHSKSASVHISVIDINEYSPTFLQPSYVTEVDEGRLYQEIIRVEATDKDCTPLFGD
VCKYEILTNDQPFTIDNEGSIRNTEPLSHKISHNHILSVVAYDCAMKQSAPVMVNIRVRR
VCEAHVMGVAERIDYVANSMESVSLFPKIHLELCDMQCKGEDMVIQSSVSLKTKHISFGC
DRDASQCLRRLSESGSGRERDGDGLVDLLQKNTDWTKDLTYDEGAEAIFHFDGSSGAIVP
KNVVQPQDFAAHQFSIVTMFRHNSIVSTDKHTKEHIVCSADDHKMNRHHMALFVRNCRLI
LLLRKDFNDGDLNIFSPAEWRWKIPQVCDNEWHHYTINVDLPKVDLYIDGIRFESNVEDR
HSNPEVIDDWPLHAAHGINTTLAIGACYQGSENRLKHGFSGDIAEIKLSTRKVLTASQIR
CGTDCAEKLLPPADHYLEPEQQIQSNTQMNKIIIEGSNKTNIEQLLQQIQYINSKESPTI
GRRNIQVMTTVSCPNKKAIRLPTIDTYIMVSSAGSSLTGGSMLASATSSSSSSGLYNKIL
VDKPLATDQKPQIVISGNSNHLVSYPDIKEGVKILAQINISVYTGKDIRPELQKLDSCNV
NVFPSLNPDHEEITIDDKDGADESLFKFDIKTQISKEGVEMIGYDTIENYQHVLKSLVYI
NKKPAYYLNRVFKLTCSQVDDHFRSAEYTLTLTVLHPKQQPTSSIASASAPSSNVLLAIS
TAPSEQHPAVAVDSHDNANQYAHVMLHSHDVQESQSKVRSSGGAALLGHEKLASSHSTML
IVVICGSFVLLICGVGIARLRNSNAALAGGSSGHGAAGGAAGGSAFARNLTDKHLPCPKV
APDQQLDWDDSALTITINPMQHDALSDESSESDNSDSEDEEVLNGRYKNVSQLEWDNSTI
Download sequence
Identical sequences A0NBK0
7165.AGAP007103-PB AGAP007103-PA|hypothetical AGAP007103-PB|hypothetical AGAP007103-PC|hypothetical AGAP007103-PD|hypothetical XP_001237120.2.40869 XP_001237121.2.40869 XP_001688049.1.40869 XP_001688050.1.40869 AGAP007103-PA AGAP007103-PB AGAP007103-PC AGAP007103-PD

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]