SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP007203-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP007203-PA
Domain Number 1 Region: 1132-1333
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.91e-33
Family Laminin G-like module 0.006
Further Details:      
 
Domain Number 2 Region: 538-645
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-22
Family Cadherin 0.0015
Further Details:      
 
Domain Number 3 Region: 206-313
Classification Level Classification E-value
Superfamily Cadherin-like 1.34e-21
Family Cadherin 0.0013
Further Details:      
 
Domain Number 4 Region: 427-514
Classification Level Classification E-value
Superfamily Cadherin-like 1.36e-18
Family Cadherin 0.0019
Further Details:      
 
Domain Number 5 Region: 633-759
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-16
Family Cadherin 0.0023
Further Details:      
 
Domain Number 6 Region: 103-205
Classification Level Classification E-value
Superfamily Cadherin-like 4.57e-16
Family Cadherin 0.0045
Further Details:      
 
Domain Number 7 Region: 747-854
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000471
Family Cadherin 0.0098
Further Details:      
 
Domain Number 8 Region: 852-957
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000443
Family Cadherin 0.0058
Further Details:      
 
Domain Number 9 Region: 358-433
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000628
Family Cadherin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP007203-PA   Gene: AGAP007203   Transcript: AGAP007203-RA
Sequence length 1524
Comment pep:novel chromosome:AgamP3:2L:44295910:44300623:1 gene:AGAP007203 transcript:AGAP007203-RA
Sequence
MSTVASVASSSRGSTSQQANSAAELHRLGGVSQLYDYRRELLLAGGERRKRSAFSTLYDT
GNTLSVNEYGGGPVSSGNVGSGNGGSSRESYVGPELLRDNRKPSFVECDSYKPMLKEEQP
VGTPVLRVTASDPDPRQTIEYSFVTTPGERARFRIDKSTGDITTAHIFDRDEPIREKEIY
ITVRATDNGRPRLDDVCTFKVTILDINDNPPVFDKVRYEESVTKDMKANLRVATISATDM
DDGDNSIIKYEIVQQNPDSSYFKINENNGLLTLTKPVDRSPGQYYSIRVRAYNVDPQGEA
VQDAEVDVKVRVVESNKLPPYFTKVQAAALVLNETFKNYTESLAEFEAESNIPEKPEVIF
ELIQGRAEQTNSKNTFLLEQINNTASIKLGKTLDYETVTEYTLTVSVKNSHDLVAETVLK
IKVLDENDIIPVFTEVTSGTIPEDEPPGTPVMQVRAYDLDGTPANNIVSYRFDDENQQLF
HIDSRTGNITSRVEFDREATDSYHLKIIAEDNSPSALYRNGKPNSISQLFIIKISDKNDH
QPKFVKDHFVAENVPEDANINTVVIEVTALDQDTASLITYSIIEGNVGDAFKIDENTGRI
SVNSRLDYETIREYMLIVQADDGIFQDNATVSIKIENVNDNPPRFIDLRNVTIQEETIPP
GCIMTIQAYDPDIENRDEPQHIRFSFVKEQEDLLEIDDTGCLRLRKALDRDPPQGFKSWQ
FIITATDEDGAGKKTPATVNIFLEDINDNAPRLSNAMPVVWGENRSPGLIVRLTAEDVDE
AQNGPPFHFSIDPNAPYEIKERFQVQNDELYALVEFDREEQKEYRVPIRISDSGEEPMSD
VSILQLVIGDDNDNEMRPGESRIFVYNYKGESPNTEVGRVYVDDPDDWDLPDKTFMWDDA
TRHQSVDFFDLNRDTGMITMLQGTRGGDYELNFHVIEQSSHFPRHNVTAKVTVTVKEIPE
EAVDKSGSIRFHNVTAEEFVSRTPGQLTTPKDRLQASIANTLNVSRENVDVFTVLKRDNV
NGTFLDVRFSAHGSPYYAPERLNGMMGYRLRQLEEDVGFSVLMVGIDECIEEGRNCELSC
KNTLYKSNVPIAVYTNTSSFVGVNAFVQAECVCEAPSPSLTCLNGGFLVNDRCSCPEGFE
GPHCEMLGIGFYGSGYALYPPISPCNMTRISVELSPQQEDGLVMYIGPLNYNPRLPVQDF
LALELVKGLPVLLLDYGSGTIRIEHRHRFPQGKPFTVEIVLQPQTIEMIVDNCKLSTCMS
LDAPKGPNRFLNVNAPLQLGGAAVNLDYLGSLFNWTYVPQDKGFSGCLRNLTINERTYDL
GLPSLAKNADPGCQRSVAVAVSFGIDSYFLIAIIACIVVLLILLLAVVVHKKHQDGWHEK
DMDDIRETIINYEEEGGGERDAEYDLTVLQGPPIYLDKPYGSELRQKEANTEVPDIGAFL
TDKKDACDKDADAYPIDDVRHYAYEGDGNSTGSLSSLASCTDEGDLKFNYLSNFGPRFRK
LADMYGEEPSDTDSNVDDEEGWRI
Download sequence
Identical sequences Q7PT49
7165.AGAP007203-PA AGAP007203-PA AGAP007203-PA|hypothetical XP_308578.4.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]