SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP007203-PB from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP007203-PB
Domain Number 1 Region: 1019-1220
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.11e-33
Family Laminin G-like module 0.006
Further Details:      
 
Domain Number 2 Region: 425-532
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-22
Family Cadherin 0.0015
Further Details:      
 
Domain Number 3 Region: 93-200
Classification Level Classification E-value
Superfamily Cadherin-like 1.21e-21
Family Cadherin 0.0013
Further Details:      
 
Domain Number 4 Region: 314-401
Classification Level Classification E-value
Superfamily Cadherin-like 1.23e-18
Family Cadherin 0.0019
Further Details:      
 
Domain Number 5 Region: 520-646
Classification Level Classification E-value
Superfamily Cadherin-like 1.41e-16
Family Cadherin 0.0023
Further Details:      
 
Domain Number 6 Region: 3-93
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000485
Family Cadherin 0.0055
Further Details:      
 
Domain Number 7 Region: 634-741
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000428
Family Cadherin 0.0098
Further Details:      
 
Domain Number 8 Region: 739-844
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000004
Family Cadherin 0.0058
Further Details:      
 
Domain Number 9 Region: 245-320
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000571
Family Cadherin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP007203-PB   Gene: AGAP007203   Transcript: AGAP007203-RB
Sequence length 1411
Comment pep:novel chromosome:AgamP3:2L:44275491:44300623:1 gene:AGAP007203 transcript:AGAP007203-RB
Sequence
MLKEEQPVGTPVLRVTASDPDPRQTIEYSFVTTPGERARFRIDKSTGDITTAHIFDRDEP
IREKEIYITVRATDNGRPRLDDVCTFKVTILDINDNPPVFDKVRYEESVTKDMKANLRVA
TISATDMDDGDNSIIKYEIVQQNPDSSYFKINENNGLLTLTKPVDRSPGQYYSIRVRAYN
VDPQGEAVQDAEVDVKVRVVESNKLPPYFTKVQAAALVLNETFKNYTESLAEFEAESNIP
EKPEVIFELIQGRAEQTNSKNTFLLEQINNTASIKLGKTLDYETVTEYTLTVSVKNSHDL
VAETVLKIKVLDENDIIPVFTEVTSGTIPEDEPPGTPVMQVRAYDLDGTPANNIVSYRFD
DENQQLFHIDSRTGNITSRVEFDREATDSYHLKIIAEDNSPSALYRNGKPNSISQLFIIK
ISDKNDHQPKFVKDHFVAENVPEDANINTVVIEVTALDQDTASLITYSIIEGNVGDAFKI
DENTGRISVNSRLDYETIREYMLIVQADDGIFQDNATVSIKIENVNDNPPRFIDLRNVTI
QEETIPPGCIMTIQAYDPDIENRDEPQHIRFSFVKEQEDLLEIDDTGCLRLRKALDRDPP
QGFKSWQFIITATDEDGAGKKTPATVNIFLEDINDNAPRLSNAMPVVWGENRSPGLIVRL
TAEDVDEAQNGPPFHFSIDPNAPYEIKERFQVQNDELYALVEFDREEQKEYRVPIRISDS
GEEPMSDVSILQLVIGDDNDNEMRPGESRIFVYNYKGESPNTEVGRVYVDDPDDWDLPDK
TFMWDDATRHQSVDFFDLNRDTGMITMLQGTRGGDYELNFHVIEQSSHFPRHNVTAKVTV
TVKEIPEEAVDKSGSIRFHNVTAEEFVSRTPGQLTTPKDRLQASIANTLNVSRENVDVFT
VLKRDNVNGTFLDVRFSAHGSPYYAPERLNGMMGYRLRQLEEDVGFSVLMVGIDECIEEG
RNCELSCKNTLYKSNVPIAVYTNTSSFVGVNAFVQAECVCEAPSPSLTCLNGGFLVNDRC
SCPEGFEGPHCEMLGIGFYGSGYALYPPISPCNMTRISVELSPQQEDGLVMYIGPLNYNP
RLPVQDFLALELVKGLPVLLLDYGSGTIRIEHRHRFPQGKPFTVEIVLQPQTIEMIVDNC
KLSTCMSLDAPKGPNRFLNVNAPLQLGGAAVNLDYLGSLFNWTYVPQDKGFSGCLRNLTI
NERTYDLGLPSLAKNADPGCQRSVAVAVSFGIDSYFLIAIIACIVVLLILLLAVVVHKKH
QDGWHEKDMDDIRETIINYEEEGGGERDAEYDLTVLQGPPIYLDKPYGSELRQKEANTEV
PDIGAFLTDKKDACDKDADAYPIDDVRHYAYEGDGNSTGSLSSLASCTDEGDLKFNYLSN
FGPRFRKLADMYGEEPSDTDSNVDDEEGWRI
Download sequence
Identical sequences A7URL5
AGAP007203-PB XP_001688008.1.40869 AGAP007203-PB|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]