SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP007207-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP007207-PA
Domain Number 1 Region: 998-1192
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.29e-33
Family Laminin G-like module 0.0064
Further Details:      
 
Domain Number 2 Region: 93-200
Classification Level Classification E-value
Superfamily Cadherin-like 1.07e-21
Family Cadherin 0.0013
Further Details:      
 
Domain Number 3 Region: 314-403
Classification Level Classification E-value
Superfamily Cadherin-like 8.71e-20
Family Cadherin 0.0018
Further Details:      
 
Domain Number 4 Region: 441-532
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-19
Family Cadherin 0.0042
Further Details:      
 
Domain Number 5 Region: 520-647
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-16
Family Cadherin 0.0025
Further Details:      
 
Domain Number 6 Region: 2-93
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000003
Family Cadherin 0.0033
Further Details:      
 
Domain Number 7 Region: 633-737
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000003
Family Cadherin 0.0028
Further Details:      
 
Domain Number 8 Region: 739-844
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000343
Family Cadherin 0.0058
Further Details:      
 
Domain Number 9 Region: 245-320
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000428
Family Cadherin 0.013
Further Details:      
 
Weak hits

Sequence:  AGAP007207-PA
Domain Number - Region: 1206-1252
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 0.0994
Family Neurotransmitter-gated ion-channel transmembrane pore 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP007207-PA   Gene: AGAP007207   Transcript: AGAP007207-RA
Sequence length 1268
Comment pep:novel chromosome:AgamP3:2L:44307059:44312519:1 gene:AGAP007207 transcript:AGAP007207-RA
Sequence
MLREEQPFGTPVLRVIAIDLNPRQTIEYSLVTTPGEQARFRIDKSTGDITTAHIFDRDEP
IREKEIYITVRATDNGRPRLDDVCTFKVMILDINDNPPVFDKVRYEESVTKDMKANLRVA
TISATDMDDGDNSIIKYEIVQQNPDSSYFKINENNGLLTLTKPVDRSPGQYYSIRVRAYN
VDPQGEAVQDAEVDVKVRVVESNKLPPYFTRVQAAALVLNETFTNYTESLAEFEAESNIP
EKPEVIFELIQGRAEQTNSKNTFLLEQINNTASIKLGKTLDYETVTEYTLTVSVKNSYNN
VVETVLKIKVLDENDIIPVFTEVTSGTIPENEPPGTPVMQVRAYDLDGTPANNIVSYRIE
DENQQLFHIDSRTGSITSRVEFDREATDSYHLKIIAEDNSPSALYSNGKPNSCSQLFTIK
ISDKNDHKPRFVKGLLATEDVSEDSDINMTLIEVKALDQDTASLITYSIIEGNVGDAFKI
DEHTGRISINNWLDYETIREYKLIVQADDGIFQDSTTVYIKIKNVNDNPPRFTGIRNVTI
QEETIPSGCIMTVQAYDPDIENRTDPQLIRFFYVVEYDDVIEIDDGGCLRLKRVLDRDPP
LGFNRWQFIITATDEDGAGKTTPSTVIISLEDINDNAPRLSNAMPVVWGENRPPGLIVRL
TAEDVDEAQNGPPFHFSIDPNAPYEIKERFQVQNDELYALVEFDREEQKEYRVPIRISDS
GEEPMSDVSILQLVIGDDNDNEMRPGESRIFVYNYKGESPNTEVGRVYVDDPDDWDLPDK
TFMWDDATRHQSVDFFDLNRDTGMITMLQGTRGGDYELNFHVIEQSSHFPRHNVTAKVTV
TVKEIPEEAVDKSGSIRFHNVTAEEFVSRTPGQLTTPKDRLQRDNDNGTFLDVRFSVHGS
PYYAPERLNGMMGYRLRQLEEDVGFSVLMVGIDECIEEGRNCELSCKNTLYKSNVPIAIY
TNTSSFVGVNAFVQAECVCEAPSPSLTCLNGGFLVNDRCSCPEGFEGPHCEMLGIGFYGS
GYALYPPISPCNMTRISVELSPQQEDGLVMYIGPLNYNPRLPVQDFLALELVKGLPVLLL
DYGSGTIRIEHRHRFPQGKPFTVEIVLQPQAIEMIVDNCKLSTCTSHQSDAPKGPNRFLN
VNAPLQLGGAAVNLDYLGSLFNWTYVPQNNGFSGCLRNLTINERTYDLTAPIVAKYSSRT
AAMTFGNYYILLIVLILMSTLLFLITLHFHKKYQKQKKVKNTYHTFNNWKQIRHMYTKLD
NSKPSQTR
Download sequence
Identical sequences A0NBC9
XP_001237106.2.40869 AGAP007207-PA 7165.AGAP007207-PA AGAP007207-PA|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]