SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP007216-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP007216-PA
Domain Number 1 Region: 1045-1246
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-32
Family Laminin G-like module 0.0069
Further Details:      
 
Domain Number 2 Region: 114-239
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-22
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 451-558
Classification Level Classification E-value
Superfamily Cadherin-like 5.63e-21
Family Cadherin 0.0022
Further Details:      
 
Domain Number 4 Region: 340-449
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-19
Family Cadherin 0.00062
Further Details:      
 
Domain Number 5 Region: 546-680
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-18
Family Cadherin 0.0018
Further Details:      
 
Domain Number 6 Region: 16-118
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000118
Family Cadherin 0.0016
Further Details:      
 
Domain Number 7 Region: 660-768
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000002
Family Cadherin 0.0071
Further Details:      
 
Domain Number 8 Region: 765-870
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000003
Family Cadherin 0.0069
Further Details:      
 
Domain Number 9 Region: 229-346
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000985
Family Cadherin 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP007216-PA   Gene: AGAP007216   Transcript: AGAP007216-RA
Sequence length 1424
Comment pep:novel chromosome:AgamP3:2L:44372106:44376380:-1 gene:AGAP007216 transcript:AGAP007216-RA
Sequence
NSPPEFSANQVENRKPTFNECDSYKPMLKEEQPVGTPVLHVNAIDQDPNQIIEYSLMTTP
GERVRFRIDKNTGEITTVHVFDRDEPIREKEIYISVRATDDGRPRLDDVCTLKVKIVDIN
DNSPVFDKVRYEESVAKDMKVNQRVGTISATDMDDGDNSLIKYELLQSLPDSSFFQINEN
NGLVTLVKQIDRSPGQHYLIHVRAYNLNQQGEPVHHTDVEVKILVMESNKRSPYFSKLPE
ETIVLNETFKDYSKPIAIFEANSAIPEKPEVIFELIQGRTEETNSKHTFLLEQLNNVATI
KLGKALDYEIIAEYTLTVSVKNSDDLIAEAVLKIQVLDENDIIPVFPEMTSGAVLENDPP
GTQVMVVKAYDLDGTPANNIVSYRFEDESQHLFHIDNITGQIKTLAALDREQTDSYQLKV
VAEDNSPSALYRNGKPNSITKLLFIKVMDKNDNKPAFTSQHFVVEGVPEDENINTPVIEV
TARDPDATSLLHYTIVSGNEGLAFKIDNNTGRISINNRLDYETVREYTLIVQVDDGIFQD
NATVSIKVKNVNDNPPRFTGLRNVTIPEETIPSGCIMTVQAYDPDIENRSDPQHIRFFYV
DEYDDAIEIDDSGCLRLKRALDRDPPLGSKRWQFIITATDEDGAGKKTPATVIISLEDIN
DNAPRLSNTMPVVWVENRPPGLIVKLRADDVDEPQNGPPFHFSIDPNARYEIKKRFKVQG
EELHALVEFDREEQKEYQIPILIRDSGEEPMSAVSMLHLVIGDDNDNKMRPGKSRIFVYN
YKGESPNTEIGRVYVDDPDDWDLPDKTFIWDDATRHQSVAFFDLNRDTGMITMLQGTRRG
DYELNFHVIEHSRHFPRHNVTAKVTVTVKEIPEEAVDKSGSIRFHNVTAEEFVSRTPGQL
TTPKDRLQASIANTLNVSRENVDVFTVLKRDNDNGTFLDVRFSAHGSPYYAPERLNGMMG
YQLHQLEEDVGLSVLMVGIDECIEEGRNCELSCKNTLYKSNVPIAVYTNTSSFVGVNAFV
QAVCVCEAPSPSLTCLNGGFLVNDRCSCPEGFEGPHCEMLGIGFYGSGYALYPPTSPCNM
TRISVELSPQQEDGLVMYIGPLNYNPRLPVPDFLALELVKGLPVLLLDYGSGTIRIEHRH
RFPQGKPFTVEIVLQPQTIEMIVDNCKLSTCMSLDAPKGPNRFLNVNAPLQLGGAAVNLD
SLGSLFNWTYVPQDKGFSGCLRNLTINERTYDLGLPSLAKNVNSECISRSVALIASIGFT
SYYLYVIIACIILLIVLLFFIIAHKTSHDEWHDKEMDHPRGTVVHYEEEGGGECDTIYDL
NAVLGHLNLMDLDTIHYANINNDQYLGTFLLRKRAACDQAADAYPQDDVRCYAYEGDETS
YQSLSSLTSFSGSQGDLKLPNLSVPPELQMLAYSYGEESSDTEK
Download sequence
Identical sequences Q7QJ26
7165.AGAP007216-PA AGAP007216-PA AGAP007216-PA|hypothetical XP_308569.3.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]