SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP007629-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP007629-PA
Domain Number 1 Region: 831-878
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000419
Family Laminin-type module 0.00061
Further Details:      
 
Domain Number 2 Region: 444-499
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000167
Family Laminin-type module 0.0066
Further Details:      
 
Domain Number 3 Region: 728-779
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000307
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 4 Region: 940-981
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000977
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 5 Region: 282-344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000128
Family Laminin-type module 0.044
Further Details:      
 
Domain Number 6 Region: 886-937
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000137
Family Laminin-type module 0.003
Further Details:      
 
Domain Number 7 Region: 397-444
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000226
Family Laminin-type module 0.0069
Further Details:      
 
Domain Number 8 Region: 783-833
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000176
Family Laminin-type module 0.0083
Further Details:      
 
Weak hits

Sequence:  AGAP007629-PA
Domain Number - Region: 342-387
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000131
Family Laminin-type module 0.023
Further Details:      
 
Domain Number - Region: 691-730
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000156
Family Laminin-type module 0.088
Further Details:      
 
Domain Number - Region: 988-1034
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00165
Family Laminin-type module 0.013
Further Details:      
 
Domain Number - Region: 96-170
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00383
Family Galactose-binding domain 0.078
Further Details:      
 
Domain Number - Region: 1232-1318
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 0.0183
Family Chemotaxis phosphatase CheZ 0.012
Further Details:      
 
Domain Number - Region: 1346-1370
Classification Level Classification E-value
Superfamily DNA helicase RuvA subunit, C-terminal domain 0.0837
Family DNA helicase RuvA subunit, C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP007629-PA   Gene: AGAP007629   Transcript: AGAP007629-RA
Sequence length 1624
Comment pep:known chromosome:AgamP3:2L:48475335:48483780:1 gene:AGAP007629 transcript:AGAP007629-RA
Sequence
MTLRVRARLAALTAATVLLLLVLTTTSANENTHYLPPLECVDPYGRPQRCIPEFENAAYQ
LQVEATNTCGDETDTDFCVQTGYSNRKSCDVCHAGQHSPQFLTDFHDPNNPTWWQSETMF
EGVQYPNQVNLTLGLGKSFDITYIRIVFHSPRPESFAIYKRVTPNGPWIPYQYYSATCRD
TYGLPDSLSVMNGEDESRALCTSEYSDISPLRDGNIAFSSLEGRPSAINFDHHLELQQWV
TATDIRITLDRLNTFGDEVFGDAQVLKSYFYAIADIAVGARCKCNGHASECTTSTALDGQ
RTRVCKCMHFTDGPDCDRCLPFYNDAPWGRATSKNVHECKPCNCNGYSTKCFFDRHLYNL
TGHGGHCIDCGANRDGPNCERCKENFFMREDGYCINCGCDPVGSRSLQCNAEGRCQCKPG
VTGEKCDRCDSNYFNFGPHGCQPCNCDERGSLDNTPSCDPVTGVCSCKENVEGRHCRECR
LGYFNLDAENKFGCTPCFCYGHTLECTSASGYSIVSTTSNFNKHKEKWTAISDTGVPVDV
KYNSHSQSIGVGANGHRTVYFLAPDRFLGDQRASYNRLFKFRLQLVGQPRVEVSPYDVVL
QGGNSSISLPIFAQNQRMPSEESHEFAFRLHENPEYTWHPSNSGRGFMSILSNLTAVKIR
AIYGDYGEAILDDVELQTAHRGAAGRQATWIEQCTCPEGYLGQFCESCAPGYRHNPARGG
PFMPCVPCDCNKHAEICDSETGRCICQHNTAGDTCDQCAKGYYGNALGGTPYDCKRCPCP
NNGACMQMAGDTVICLECPVGYFGPRCELCSDGYYGDPTGVYGSVRMCQPCDCNGNVDPN
AVGNCNRTTGECLKCIHNTAGPHCDQCLPGHFGDPLAEPHGSCEECSCYPRGTEQTEKGI
SICDAINGNCHCKPNVIGRTCNECKNGYWNIVSGNGCESCNCDPIGSYNASCDTYSGDCF
CKPGVVGKKCDKCAPAYYGFSEDGCHACDCDPSGSKGSQCNQYGQCPCNDNVEGRRCDRC
KENKYDRHQGCLDCPACYNLVQDAANDHRAKLAELNQILQDIQSKPIVIDDSEFAGKLHA
VQEKIDILVEDAKSGSGGGEKTLNEILRELEARLQEVQKLLDNADQSQEVTNHKISKGGY
NATLANGKIQDARRQLDNAIELLQTEGNTALARAKDISGHLGNQTNQISGISREARQYAD
RFKAEADANMKQAQEAHKKASEALKKANDAFNQQANITKELDTSISSEIAQAREKLNTVS
KLTEQALTRAREVNDEALTLFAAVNRTAPPNIDIDKIKKEANQYNREADRIAEDLANKMR
DHAQLLENVGTNIELAETLLDRASLQKEDAVDALKQLKYAKEQAEKAVAEGDGTLQKANY
TYQTLAGFKNQVEESSRRAEEALNLVPNIERQIVNSRDLLQRAEEALYAASRNAEDARKN
AQTAQDKYAEEASKLAENIKKRANATKNTARDLHHEADQLNGRLAKTDNRLEEREAQIRK
DLNLTNEAKEKVGQAQLNSNEAKSQVDKAMREVSLIMSELANLREIDVNSLDDLERRLSA
AEKELEDAQLTKRLSSLVEAKNIQNQNIRSYQKELADLRLEVANIELIANSLPPGCFKRT
HLEP
Download sequence
Identical sequences A0A182I3P9 A0A182KRT0 Q7QJR9
AGAP007629-PA|laminin AGAP007629-PB|laminin AGAP007629-PA AGAP007629-PB 7165.AGAP007629-PA XP_001687877.1.40869 XP_308240.3.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]