SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP007686-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  AGAP007686-PA
Domain Number - Region: 33-113
Classification Level Classification E-value
Superfamily Cadherin-like 0.00137
Family Dystroglycan, N-terminal domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP007686-PA   Gene: AGAP007686   Transcript: AGAP007686-RA
Sequence length 422
Comment pep:novel chromosome:AgamP3:2L:49055238:49060559:-1 gene:AGAP007686 transcript:AGAP007686-RA
Sequence
MDKMSKMTVVLFAVLLTTASLALGKETTYKTDDVSVSELFSLRIEPRMFNWTYEGLSEQF
LYRSSLEGYPDLPSWIRYMYSPEYHSGFLYGTPPLRTADTRVPIEIIALNRLTYETKRLI
LMLAIHRKQPAKHVIQMKIDNLNWVHMMDPGRIENLKNIFRNDLWPESRPDLHVIFMDSA
VKLGARLPLRPQQREGVVVHLGSSAEFSKRMLELQEEVKPLYKISSCTYKRTSVQTTFEN
SGFKLDWCAFRMVTLPHHPNESHKHGAGRKEHQHFQLPHSFPDKWDAPLKSEVPERNYSD
EIAISFAIPGMIFALLLCGLTIILCFQHEKLMQKSSRTEYSPAAPNVQMVHYSPDDIKST
IKLKSLRDVPFDDTHSISPTDSFYREGSPHIGNMYMRPKPPPYKLAGNANSPTLKRNGNV
EM
Download sequence
Identical sequences Q7PTB8
7165.AGAP007686-PA AGAP007686-PA|hypothetical AGAP007686-PA XP_308185.4.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]