SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP007905-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP007905-PA
Domain Number 1 Region: 518-633
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-31
Family Cadherin 0.00069
Further Details:      
 
Domain Number 2 Region: 1626-1750
Classification Level Classification E-value
Superfamily Cadherin-like 1.01e-29
Family Cadherin 0.0013
Further Details:      
 
Domain Number 3 Region: 403-522
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-28
Family Cadherin 0.00091
Further Details:      
 
Domain Number 4 Region: 291-401
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-26
Family Cadherin 0.0018
Further Details:      
 
Domain Number 5 Region: 847-973
Classification Level Classification E-value
Superfamily Cadherin-like 6.15e-26
Family Cadherin 0.00091
Further Details:      
 
Domain Number 6 Region: 1309-1412
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-25
Family Cadherin 0.0017
Further Details:      
 
Domain Number 7 Region: 626-734
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-25
Family Cadherin 0.001
Further Details:      
 
Domain Number 8 Region: 1204-1315
Classification Level Classification E-value
Superfamily Cadherin-like 8.25e-25
Family Cadherin 0.0019
Further Details:      
 
Domain Number 9 Region: 190-298
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-23
Family Cadherin 0.0019
Further Details:      
 
Domain Number 10 Region: 77-194
Classification Level Classification E-value
Superfamily Cadherin-like 1.3e-21
Family Cadherin 0.0017
Further Details:      
 
Domain Number 11 Region: 2068-2174
Classification Level Classification E-value
Superfamily Cadherin-like 5.85e-21
Family Cadherin 0.00093
Further Details:      
 
Domain Number 12 Region: 958-1096
Classification Level Classification E-value
Superfamily Cadherin-like 6e-21
Family Cadherin 0.0079
Further Details:      
 
Domain Number 13 Region: 2170-2301
Classification Level Classification E-value
Superfamily Cadherin-like 7.28e-21
Family Cadherin 0.0028
Further Details:      
 
Domain Number 14 Region: 1834-1978
Classification Level Classification E-value
Superfamily Cadherin-like 8.11e-21
Family Cadherin 0.0033
Further Details:      
 
Domain Number 15 Region: 1737-1839
Classification Level Classification E-value
Superfamily Cadherin-like 9.03e-21
Family Cadherin 0.0023
Further Details:      
 
Domain Number 16 Region: 1408-1526
Classification Level Classification E-value
Superfamily Cadherin-like 9.82e-21
Family Cadherin 0.0027
Further Details:      
 
Domain Number 17 Region: 1-83
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-18
Family Cadherin 0.0069
Further Details:      
 
Domain Number 18 Region: 1084-1210
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-17
Family Cadherin 0.0015
Further Details:      
 
Domain Number 19 Region: 735-851
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000385
Family Cadherin 0.002
Further Details:      
 
Domain Number 20 Region: 1526-1630
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000186
Family Cadherin 0.0052
Further Details:      
 
Domain Number 21 Region: 1956-2074
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000385
Family Cadherin 0.0039
Further Details:      
 
Domain Number 22 Region: 2282-2394
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000428
Family Cadherin 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP007905-PA   Gene: AGAP007905   Transcript: AGAP007905-RA
Sequence length 2864
Comment pep:novel chromosome:AgamP3:3R:2610532:2619915:-1 gene:AGAP007905 transcript:AGAP007905-RA
Sequence
VSATDPDCGVNAMVNYTLGEGYKKNAEFEIRPSTGEVCIASELDYETRNSYEFPIIATDR
GGLSTTAMVKIQLTDVNDNRPTFYPREYNVSLRESMPTNSLLSTPVVVVVATDSDSGSFG
TISYRIVAGNEAGIFRMDRLTGEIFVTRPNMLSSRTQPYHRLNISASDGGGLRSTHDAEV
FISVIDATQRPPIFDKPRYTYYVKEDVKRNTVVGTVSATSSNSGNRGSLRYFIYSGDPDG
FFAIDPVSGNIRVANALDHETKPQVLLNIQATSGDPPAYGHTQVNIDIEDVNDNPPEFES
NTVRISVPENVEIGSPLYEANAQDKDSGMSGVITYMLAGQGNTLSGARSSLFSMDSRSGH
LTLARPLDYESMQRHTLVVTASDSGTPSLSTNLTILVEVQDVNDNAPIFEKNEYAISVIE
STPSNSQILQVSATDADTGNNARLTYKILGEDHQRTGKSTQPASPDEPVAEIFGIFPNSG
WIYLRTKLDREVKERYNITVIVSDNGVPTLTATAHVIVTILDANDNSPIFAKSLYEFEIE
ENMRRGAMIGTVSASDSDAGINAVVRYSLIPSNTSFQINPVSGEITTRDSLDRETKASYD
LVVEARDQGTPYRSSRVSVKVQILDVNDNAPDIVDPQEDVVSVREEQPIGTEVVKVRAID
RDHGQNASISYSILKGRDSDGYGMFSIDPMSGVIRTKTSLDHEEKTIYRLAVAATDNGKP
PKQTVRLLRIEVLDLNDNRPTFTSSSLVFRLREDVGVGHIIGSISGNEQSDAENFISSSS
DLHITYTLTPLTNDITEGAFDIDRNSGKLVVARQLDREQQSEYRMEIRALDTSASNNPQS
SAVTVKIEIADVNDNPPKWPSDPINVYVSEDTPVGAIVYNFTVQDNDTGTNAEIKYNLSK
PAHLAQKEYFAIDSLTGSLTLLAPLDHEDTQEFLLIVQATDQSSNVTERLTTSATARIMV
TDVNDNSPKFVIPQAADGVVYISDSLEIDQVVSHVVAIDPDSGENGHIAYTFVGGNEDER
FTIDSSTGVIRLAKPFSSNFIMDSGKRNSVSGKYQLVISASDHGSPRPREAKMTLQVVIQ
NMTNNPPRFVEPVYHVNITENVPSGSFVVRVSARSHSDGGSGAGLNLTYEIPKGVGEDHF
AVDSVRGIVTTRGTFDRESKDLYTIPIYVTEGGRFKKPSSSAASSQDMAQFDVATLVVRV
TDVNDHAPEFVQGSCYPLAVPENSELSVIHTVVATDADDGLNGEITYSISGGNMGNKFSI
DLHTGALTARPLDREVHARYVLQITAQDRGSPVSHQGHCNITIRVEDENDNDPKFELQKY
IATIDEDAQIGTTVLTVKAIDADVGINARIVYSLANVTEWLFDIDSKTGVITTAGLFDRE
RQNVYNFMVVAMDGGRYNARSQNVPVQVIIADVNDNKPVFDKYPFREQIGALVQPGQTLL
HISATDSDQGSNGEIVYSLNENASNGKFRINPTTGALSATQSLASENGRLLHIEVTARDK
GNPPQIATGLIELRVGEVQQELPVLRFQNSSYRVTLSENTPVGQPVLQLSAVRSDGRRQK
IIYSFGSGNEDGTFSIDAVTGDVRIRNSHNLDYERFSRLKSEGIELVAVARTDGTPLLYG
YTSITVELRDENDNAPRFTQQQYAASVWEGNSKGTFVIKVGAFDSDQGANARILYHIVDG
NHDNAFIIEPAFSGIVKTNIVLDREIRDKYKLKVIATDEGVPQMTGTATINVNVVDVNDN
QPTFPPNTVISVSEATSVGTVLTTITANDVDTNPPLTYSFAELSDDDATSYFSIDRYSGK
IILIRPLDYEDRHEFLLRLLASDSAHVARTTLTVRVVDVNDNAPVFQQITYHAMLSDSTD
GSNTNVMILSVNATDADSEPNAIVRYSIVPPKGMVMASGFTIDESTGQLFANVSQLSTSG
AGGTLYLTVRATDSGQPALSSTTTVRLEMKSKGKANPQYIQSQYRVSMNEEALPGTTVVN
LIPKSILQQQSGAESAIAFEIIDGNEGSVFDVTYPEGAIVLVDRLDRERVDYYELKLVTV
EPGTRHISRPDASLSTIIRVIVTVEDANDNAPEFQPGSYEATIGELAPIKHSIAKLSALD
ADLSGSPSSEVIYQIISGNDSGMFSIDLVSGLLYTNKYLDYDHGQTQYSLVVRACDSHSA
PRCSVHPFTIALSDENDNEPQFPVPEYLEFVGENEPIGISIFTARATDMDRGPFGTVNYT
IDSVLSGAYSGLDDSWKLFKVDPTSGVVNSNAVFDYEEKNRYAFALRATDTGGKSKTVRV
KIVIESRDEFSPQFTERTYRFVIKTPESGQLPVGYVVGHVTATDRDRGPDGRIVYQLTTQ
HPYFKMNRTTGAILIKKRLDNVASMLEAGRDISLVVTAGSGRQGSLTNMTVVEIAIDALA
HLKGNELGSGSGGGGGYENSQSVSAGGGFANWAVGLVISLLLIIVGVASVFLFLHMRNRQ
QKHVNKTGLSSESVGHSNNYVDPSAFDTIPIRGSSSGATGAGQFAPPKYDEIPPYGASSN
SGAATTSELSGSEQSGSSGRGSAEDDGEDEEIRMINEGGPLQRDGLQLDGRLSDVSVQNT
QEYLARLGIVDNGTTGNASKDAMLHTLPIDTLHMFHDDEHHRESDLTNLIYAKLNDVTNN
SDRASSVDETVTNAGSIGATVDHVMMGGYGDVPVVGNQQGISMNGSLSSIVHSEEELTGS
YNWDYLLDWGPQYQPLAHVFSEIARLKDDTLSVQSGNSGASSAKSKNSLHHTVKTLPPPL
LTNVAPRSINVPVFAGRNNPGSHHGGAPNQYLLPRSPISHDSAAGFSTSSAMSPSFSPSL
SPLATRSPSISPHVVSTGMPTSHHMVSLPRPPQQRGPAGQRKPY
Download sequence
Identical sequences Q7Q3J3
7165.AGAP007905-PA XP_317578.4.40869 AGAP007905-PA AGAP007905-PA|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]