SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP007909-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP007909-PA
Domain Number 1 Region: 118-240
Classification Level Classification E-value
Superfamily Cadherin-like 2.36e-36
Family Cadherin 0.00088
Further Details:      
 
Domain Number 2 Region: 265-361
Classification Level Classification E-value
Superfamily Cadherin-like 1.16e-24
Family Cadherin 0.0019
Further Details:      
 
Domain Number 3 Region: 12-130
Classification Level Classification E-value
Superfamily Cadherin-like 1.18e-22
Family Cadherin 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP007909-PA   Gene: AGAP007909   Transcript: AGAP007909-RA
Sequence length 361
Comment pep:novel chromosome:AgamP3:3R:2671044:2672384:-1 gene:AGAP007909 transcript:AGAP007909-RA
Sequence
NVRVVVRVLDENDNAPTFPTPIMSIEFPENTPRDVKRTLNPARDADLGRYNTQRYSIVSG
NVNNAFRLSSHRERDGVLYLDLQINGFLDRETTPAYSLVVEALDGGSPPLRGQMTVNITI
QDVNDNQPIFNQSRYFATVPENATLGTTVLQVYATDQDAGENGQVEYAINRRQSDKEQMF
RIDPATGLISVNKPLDFETRELHELVVVAKDRGMQPLETTAFVSIRVTDVNDNQPIINVI
FLSDDATPKISESAQPGEFVARISDVYHANVMEVADPGTSVIQVTAVDRDEGNNSAIVYS
LLDTPDTHSHWFQIDSHSGLITTRAHIDCETDPVPQLIVMAQDNGRPPLSSTGTVLVTIH
D
Download sequence
Identical sequences Q5TQ50
7165.AGAP007909-PA AGAP007909-PA AGAP007909-PA|hypothetical XP_555589.3.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]