SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP008132-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  AGAP008132-PA
Domain Number - Region: 207-229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0838
Family Integrin beta EGF-like domains 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP008132-PA   Gene: AGAP008132   Transcript: AGAP008132-RA
Sequence length 554
Comment pep:novel chromosome:AgamP3:3R:6014024:6016277:1 gene:AGAP008132 transcript:AGAP008132-RA
Sequence
MSPGAKRKLPDVRLFLWGLFLLQISLICLFLLFGSLLVSTTIDTAEDGSGATGGNPPPQT
AEQQQDVQRIGTSFAVWSPFGVRDVDGRQLLRDQKQQRPRHPKYRPWLQRDVPKAERAEK
YFRTISYTDWQGNRKRRLCFIEGTQGGALVGAAGATGKRTGNNETEPIDTGMRRTLPEGA
ANELNNNNNNHDSQPANDDGDSVVTVGDDGVGRCRCNPQWHGADCGQPEVIWRAFITSKI
PPRDQTATPRPVARNLYYIVPSTFISAEVLEIQLMELADQVALFVLCDRPGTGAPGTTPY
AASIAHHVDGTDFLRTLRDRLLIVSDVACSGRNMFRKLLKYTAKGAVRADDLVLIGGTDE
ILNRKAVAYLRWYDNWPQPVRFRLKHNVYGFFWQHPGNSTVIGSGAVQVSTLREVYGSDP
DRVLAIEKPVMLIGDLNHFGGWYCRRCYQPGSIVQYYEYRAAQQGAVGGTMDATPVVLPD
PKRTKVLNDEYVQQLIAAGKDLEDGERPLERLSRRTDKYYQPEYVRDNSWRFDNIVLNLF
ARWDDNLADDDYFS
Download sequence
Identical sequences A0NF49
AGAP008132-PA XP_001237912.2.40869 7165.AGAP008132-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]