SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP008185-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP008185-PA
Domain Number 1 Region: 1629-1903
Classification Level Classification E-value
Superfamily Kelch motif 3.53e-45
Family Kelch motif 0.012
Further Details:      
 
Domain Number 2 Region: 204-270,333-438,505-604
Classification Level Classification E-value
Superfamily Kelch motif 1.18e-33
Family Kelch motif 0.013
Further Details:      
 
Domain Number 3 Region: 37-146
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-21
Family Spermadhesin, CUB domain 0.00093
Further Details:      
 
Domain Number 4 Region: 1212-1247
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000142
Family EGF-type module 0.015
Further Details:      
 
Domain Number 5 Region: 2271-2411
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000173
Family Growth factor receptor domain 0.0048
Further Details:      
 
Domain Number 6 Region: 1335-1383
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000218
Family Laminin-type module 0.0088
Further Details:      
 
Domain Number 7 Region: 2358-2407
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 8 Region: 1207-1338
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000565
Family Growth factor receptor domain 0.0081
Further Details:      
 
Domain Number 9 Region: 2444-2484
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000711
Family Laminin-type module 0.05
Further Details:      
 
Weak hits

Sequence:  AGAP008185-PA
Domain Number - Region: 1456-1530
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000602
Family Spermadhesin, CUB domain 0.0072
Further Details:      
 
Domain Number - Region: 142-205
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0113
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 1770-1814,1915-2034
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0275
Family WD40-repeat 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP008185-PA   Gene: AGAP008185   Transcript: AGAP008185-RA
Sequence length 2914
Comment pep:novel chromosome:AgamP3:3R:6453504:6462729:1 gene:AGAP008185 transcript:AGAP008185-RA
Sequence
MVWLVVLVQLLLPYVHVGLTLAKLQTARQSCDKTRRIFTQSYGEISDGPAGSNYTQDSHC
EWLIRAQNDSQFITLKFRSMGTECSYDYIFIYDGDSFRSPLLGSFSGNTEPQHVIASSGS
MLILLYSDTNYVLEGFRAEFSVTNCPNNCTGNGRCVDHVCVCDRGWIGSDCSLDACPERC
GVGENRGTCAGDRCECSKDYLGQSCGLHRTNPAPKEWHWLSNSKNGLPPRAAHTAIYYEP
ADALYVFGGYNLNEVFDSMYVFRFERNQWEDEWGIRVDQNHTEPSSEEEKLLRRAQFLEE
ESERLSREPNFLSNVIYTLSDNRTGIGYGEGLSNGSRPTGRYGHAAAAVTDGFVVFGGKL
ASGELANDLWLYNVSHNGGSWFERATDSSIRPPALTRHTLTLAGEFLYVFGGAMEDGEFS
SKLFRIRLVPDAPEEDAWEEVIPRGGKSLDVRMVAHTTSYQRATHSLIVYGGLVANVARF
SRLSERMFAFQLDHKHWAELQYPRTALHDGYAPRERAFHTTNIIGNYLLVFGGYSHKHNK
EEICYDNQMYLYHLGCHSWINPEVLGPGPGSKFRYPKKQGVFAHAAAVRRGNTLLVVGGY
HGNVNGDLLAYTLPLMLVVHDDVAFAPEAACPRHTSFNECLADLECGWCSADSVCYGRTI
GANCTTNLQTTRCKGICSVLGDCHSCLVHGTSTLDEGGERVRKGGQHLLHMQSIAHKLGL
DRCTWCVQNARCHHKDDNYGVCGEDTPSQKPGWWGSKGTEVTKPSECTSQDKRPGLTFLK
YLHPMNVSMPDAVMIVNATMADFTSPPTNTPTEQQLGGQVVARLLGFIRFPPMTDQSMAL
LQACVSHADAVLRTVQVLSQTRRKADHSANAPLTTLALDTMVSTNITANESVCGMVKWTD
RANILVDFQAQRNSRTAGGYYGGSGGHHHHHHGHHPDLSKMSLQHFYGGVLQAFTFEFLE
PYANGTACGAYSNCLECLSDSSCGWCELTGSCLSRKANESESCRRGLNWRYLTIQPAHCS
NCSNFVSCEQCIGHSGNQCEWWTEDATCARKGRSEAAVRTLDQCPVPCYLRTDCSSCLND
RDRCVWCEATSQCFSFSVYTSEYQFGMCREWLDQTLPLGGPPTVEQDGTSVPMVQQCKSC
ASYQNCSYCLRSLSCGWCYDTDNPINGVCMQGDFNRSAQGMCERGQLLLPGATNTTEEQP
VRTSWAYAQCPDVDECELRLHDCHEQAECSNTHGSYSCKCRKGFVGDGVRYCRQTCYETC
VHGHCSGAPDFRCVCDLGWTGVGCSVNCACNNHSTCLQGVGRCDRCLNWTEGEFCERCSP
GSFGNATTEAGCQRCDCNGHGNVALGICDAKTGECYCQDYTEGLRCEMCNRNFYGDPKDG
GQCYHQCASRGVLTQVGTQGLGSFQSYRSSWSGQETRECLWIVSPQGRGGGGGGAAGGAG
GTSALSTELRNAIIQIEIEPERMNVTCGENAVYVYDGLPDLTGVAQQKQLIAVFCSEDRG
SWIAEARSGHLTVHFKKGPSPEQGFNAIYSVLSCAAASCQRPYLCSDDGRCVCPKGFTGP
RCMMRICPSDCNEESKRGTCDNGYGRCICAPGYGGDDCSLAVKSSSVVFTELFNSYLVSD
SFEHLRKTLPRFGHSLVADRRGSLWMFGGYSLSHGPLNDIRQFDTKNNTWMQVTVDSSPE
DRMPQGRYYHAADIIGSRQAIYVYGGLSRNGTLDDLWQFALQTQRWSLVVPQNATRPPAL
AGHTLTAVGREELLLLIGGYSISDRGGGLQSSVWLFNLATGTWSVVTTHGSSPRGIYGHT
AVYHAQSSAVYVYGGVRIGDSGNLAVSKRLYAFSIPTRRWTELPSFIHHGPDYVPPARYL
HSAVATEHYMLVFGGRVAGNGTVSLAREEVMVAYVYRCNQWIRLAKDAEKVGGSYGHTYA
QAMAQDPDGGSIYVVAGWDGSNHCRVTRIDLPADMCELWSGSKYFCRQYSGCSFCSVKGM
PGEPASHCYSAGGSYHACEGYNGTISFNSGTSCDSEWIGRRTCASFITCSSCLATYPWHG
EQESPCKWCPDCHPTFSCVDRTADCGMYNGCIANQTAILQDECPVGTAGGRSCLADDCEA
CLALSGCSWEREEQGGAAARYRCQERQDEAEPRNDTKVERCPLPCNAFRNCSTCVKHDSR
SSECLWSTQLNECISQTFQPLYCSGGICGLVVSPNDPQHCPEPCASFTQCSSCLRHAYCG
WCSRNGTDGDGVCTEGSVDGPANHPAGATCAAIYQTRSKAPANTTEPFGWNYFKCPPENE
CFNGHHNCNAKSQRCVDHLHGYECVCAPGYNSSSLGGGGSGGVCVPVCSQGCVRGTCTEP
DVCRCDFGYVGANCSIQCQCNGHSNCSGADQLDRCGQCHNNTMGAQCDKCLPFYVGDPRN
GGTCVPCVQYCNGQTDLCIAREQEATMRNMSRQELKRLVTEGPMADAICLGCGNYTDGDQ
CETCVPGYFRKSATPGKACSPCECNGHGDMCDPMTGEKCNCGNNTESDNTCSSKGKNHAF
NCWSLQCTKCRDSYSGHPNNGHQCYKHITVESRMCFDAKTIDECKIKPQPLKPGQTVFFV
IQPRYMNVDIRFIVDVTQGELDFYMSPTDESFIVHTNASTGDHDILLDSRYVSFPQRVAG
PTLWSPLSSSTSQPDEMYPLNIKYSEEPLAGDKSSPVCGGLLNEGFHVTDRTAHDLITYV
TLRQCKSILRVFGLKNRLVVTLPHTVHALGQTKFYIALRARPGSTASYGLVFFRQDQLHI
HLFVFFSVFFSCFFLFLAICVLAWKAKQAADMRRARRRQVVEMLHMAKRPFGRVNLSLEC
PSEGGGTTPAPQRRRGRSSKHSTGGSAGSTLEPTADNYAAVGTVFVRLPGKQKAQITLAL
ASALIVMGGRSSSGGSYPSHERAAGGRHHRRRSS
Download sequence
Identical sequences Q7Q434
XP_317282.4.40869 7165.AGAP008185-PA AGAP008185-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]