SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP008740-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  AGAP008740-PA
Domain Number - Region: 7-35
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00967
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP008740-PA   Gene: AGAP008740   Transcript: AGAP008740-RA
Sequence length 97
Comment pep:novel chromosome:AgamP3:3R:16537656:16540531:1 gene:AGAP008740 transcript:AGAP008740-RA
Sequence
RSLLSLSLCVRHHHCSLTTTARYVCVCFSNAFRGPVKVARAFSDVGPVKESEKNVCRSCK
KRLNVGNTILNSVLLNGLGVCFVTTPPLSAQCRMHPW
Download sequence
Identical sequences A0NE49
AGAP008740-PA|hypothetical AGAP008740-PA XP_001237610.1.40869 7165.AGAP008740-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]