SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP008790-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP008790-PA
Domain Number 1 Region: 345-606
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.67e-40
Family TNF-alpha converting enzyme, TACE, catalytic domain 0.00063
Further Details:      
 
Domain Number 2 Region: 621-713
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.0000053
Family Blood coagulation inhibitor (disintegrin) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP008790-PA   Gene: AGAP008790   Transcript: AGAP008790-RA
Sequence length 989
Comment pep:novel chromosome:AgamP3:3R:17873128:17881062:-1 gene:AGAP008790 transcript:AGAP008790-RA
Sequence
VSIFFCFFTARPLNEYISHYEKLSYDHEHLHASHSRAKRSVTKDHYVHLSFSAHDRDFNI
RLKRDLSTISDKLEIHTDKGPVQVDSSHIYHGEVIDDPNSYVFGSIFDGVFEGKVITSED
EYYVERAKHYFRESSNPETHPLHHTGDGEPPFHSVIYKDQHVDDPYRHRRKASPHSPKNR
VNSCQRPHDKHRSNSVNQSTQFRISSSGRVAKPAASSTVQKRKRMGPCALGNKPNTTHQQ
LVDVQCPSFRSAISNGERKEGRTSQRRASRIEQTRRSATLEKDTRPDIGANDIPIETGYE
FKYPYEKYSKAANWRASGESVTDSEWHWKAHERVRRAARPKEDYRNTCSLYIQSDPLLWS
HIRDSIVGHLHRARRNELEEKTREEILSLIIHHITAVNYIYRNTKFDGRIEHRNIRFEVQ
RLKIDDDSSCGENHHEETNPLCLENIDVSNFLNLHSLGNHEAFCLAYVFTYRDFTGGTLG
LAWVASASGASGGICEKYKTYTETVGGLYQSTKRSLNTGIITFVNYNTRVPPKVSQLTLA
HEIGHNFGSPHDYPAECRPGGNNGNYIMFASATSGIRLNNGKFSPCSVRNISNVLDAIDE
NKKRNCFQASEGAFCGNKIVEIGEECDCGFNEEECMDKCCYPREMSETMRIENVTAQSCG
RRARTQCSPSQGPCCDSNTCRFIPADARVTCKEETECSWGSTCNGTTPECPEPKPRDDKT
KCNNGTQLCIKGECSGSICLLWNMTECFLTSNIIPNIDKRKLCELACQNGNDTNSCRSTS
EFAREYGLPDGGYSLRPGSPCDNFQGYCDVFLKCRAVDAEGALVRLKNLLFNKQTLQTLA
EWATEHWYLVCMFGIAFIITMGIFIKCCAVHTPSSNPKKAAAYRISDTLRRPMNTLRMMR
RHHHNGAGPRSVPVPRGERSRSAGERGGGGGGGGGGGRGGGERNAGHNSSSSGNSRPSNS
SRPPAHGYGEGRGQQYYPPKGVFALSDPK
Download sequence
Identical sequences Q7Q858
XP_314916.4.40869 AGAP008790-PA|hypothetical AGAP008790-PA 7165.AGAP008790-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]