SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP009181-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP009181-PA
Domain Number 1 Region: 362-420
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000177
Family Variant RING domain 0.014
Further Details:      
 
Weak hits

Sequence:  AGAP009181-PA
Domain Number - Region: 18-42
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0136
Family Integrin beta EGF-like domains 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP009181-PA   Gene: AGAP009181   Transcript: AGAP009181-RA
Sequence length 513
Comment pep:novel chromosome:AgamP3:3R:28199336:28203274:1 gene:AGAP009181 transcript:AGAP009181-RA
Sequence
MGCSSIPIGETSPETVAQCSGRGDCLNGTCLCEIRYSGEECSGFNLPYHAGISAVFYFVG
FVSLVQLMICIIAEYQRLKQPSFLAACRLTTQKLLYFFVFIAAVLRGAYFTTPETLQPAW
VSYLMSLYYPLVMTCASLVVCLWAEIFHLQGIRWERSQFLSKSFLGFLAFNLLPYSLFLA
EIAYSHLFTGRSTSFFNGCYAVLLLIVVIFFLIYGVEVFFKVRGGFVYDFGVVPNSENVN
ASQLHQSRFGLLSQAIMMIVIVGFLTSETLGDFWKKKVPVYSRNWHDIVFRLAEVGVALW
FPCCLWNSMAPEQLWILNPRKLLTRQIDPVAGGSGCGAGTAEAPADPSTSANAEEGQSFL
AKKDCWICYDTDKPEPLIQPCKCIGDVSSVHHECLRRWLVDSCANSDAVLKCKVCDSPYE
IERSNRLDWEKGFTIQHWAKTIIIVTLMCITGAGAWVIIQLNEDSFVRVLVAGFAIIIGY
ILFKMLGENTVTAIQRAKVSSIYIVTSVNDLQT
Download sequence
Identical sequences A0A182UJ00 A0A182XKX3 Q7PVU7
7165.AGAP009181-PA AGAP009181-PA|hypothetical AGAP009181-PA XP_319946.4.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]