SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP009710-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP009710-PA
Domain Number 1 Region: 4-71
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-17
Family Cadherin 0.0023
Further Details:      
 
Weak hits

Sequence:  AGAP009710-PA
Domain Number - Region: 64-89
Classification Level Classification E-value
Superfamily Cadherin-like 0.000279
Family Cadherin 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP009710-PA   Gene: AGAP009710   Transcript: AGAP009710-RA
Sequence length 97
Comment pep:novel chromosome:AgamP3:3R:39440463:39440917:1 gene:AGAP009710 transcript:AGAP009710-RA
Sequence
ASGVRYKISRGNIDNVFAIRNATGALYVAKALDYEKIKKYELRLKASDNFKENYTTVLIN
VRDVNDNPPVFEKSSYRTQITEEDDRGLPKRVLRVSV
Download sequence
Identical sequences Q5TP84
AGAP009710-PA|hypothetical AGAP009710-PA XP_553523.2.40869 7165.AGAP009710-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]