SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP009715-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP009715-PA
Domain Number 1 Region: 307-438
Classification Level Classification E-value
Superfamily Cadherin-like 8.14e-28
Family Cadherin 0.002
Further Details:      
 
Domain Number 2 Region: 73-207
Classification Level Classification E-value
Superfamily Cadherin-like 9.03e-22
Family Cadherin 0.00098
Further Details:      
 
Domain Number 3 Region: 417-519
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000124
Family Cadherin 0.0041
Further Details:      
 
Domain Number 4 Region: 194-319
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000243
Family Cadherin 0.0027
Further Details:      
 
Domain Number 5 Region: 4-85
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000314
Family Cadherin 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP009715-PA   Gene: AGAP009715   Transcript: AGAP009715-RA
Sequence length 519
Comment pep:novel chromosome:AgamP3:3R:39738811:39741217:-1 gene:AGAP009715 transcript:AGAP009715-RA
Sequence
VDVERPNNIIYFLTGPGIDIENPSNSYFDINKATGEIFVLKVDPPHGRASWKFTVFAQDE
GGEGLVGFTEVQINLKDVNDNAPLFPNGIAYGNVTENGTIGMHVMTIKAEDYIDADDINE
GTNVKIIYSIEKNVIQEDTGLPIFDINPDTGLITTAVCCLDREKTSDYLLQIVATDGGGL
KGTGTASIKVKDLNDMPPRFTKDEWFVEVEETDGSVLPEAPILTVTVNDDDEINNFQYKI
IESRGYGADKFAMVKNADGTGSLKVVQPLDYEDPMQINGFRFRIQVIDNDEIDESDKYHV
DHSWVIVKLKDINDNTPRFKKPHIEAAVYENADVGKNLGTFKAVDIDKGGKSKITYSINR
ATDRKRQFAIDQEGKVTIHRELDWEAMAKYSLEILATDDGVPLRTASAILTVLVKDINDN
APVFAEDYRPIMLENSPPSKIIEISAVDKDDRLEGNGAPFQFRMDPDADDQSNKGDGMAI
ISSLGSFDREYRKQYTIPIVIKDSGTPPLTGTSTLTITI
Download sequence
Identical sequences Q5TP77
AGAP009715-PA|hypothetical 7165.AGAP009715-PA AGAP009715-PA XP_553534.3.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]