SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP009716-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP009716-PA
Domain Number 1 Region: 969-1198
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.3e-40
Family Laminin G-like module 0.0029
Further Details:      
 
Domain Number 2 Region: 1226-1405
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-29
Family Laminin G-like module 0.0028
Further Details:      
 
Domain Number 3 Region: 461-592
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-28
Family Cadherin 0.0019
Further Details:      
 
Domain Number 4 Region: 230-361
Classification Level Classification E-value
Superfamily Cadherin-like 9.14e-23
Family Cadherin 0.0004
Further Details:      
 
Domain Number 5 Region: 3-70
Classification Level Classification E-value
Superfamily Cadherin-like 4e-16
Family Cadherin 0.0022
Further Details:      
 
Domain Number 6 Region: 571-684
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000271
Family Cadherin 0.0012
Further Details:      
 
Domain Number 7 Region: 64-117,175-234
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000614
Family Cadherin 0.0053
Further Details:      
 
Domain Number 8 Region: 348-473
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000002
Family Cadherin 0.0025
Further Details:      
 
Domain Number 9 Region: 1500-1540
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000296
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 10 Region: 686-778
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000228
Family Cadherin 0.013
Further Details:      
 
Weak hits

Sequence:  AGAP009716-PA
Domain Number - Region: 899-997
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000471
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 1450-1517
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0209
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP009716-PA   Gene: AGAP009716   Transcript: AGAP009716-RA
Sequence length 1749
Comment pep:novel chromosome:AgamP3:3R:39950254:39970989:-1 gene:AGAP009716 transcript:AGAP009716-RA
Sequence
SGVRYKISSGNIGNVFAIHNTTGALYVAKALDYEKIKKYELRLTALDNFKENYTTVLINV
RDVNDNPPVFEKSSYRTQITEEDDRGLPKRVLRVTASDADVERPNNIIYFLTGPGIDIEN
PSDSNFDINKATGEILVLKKSFGFATFIRFDRSGANVHGTTRENGSFGSVMMKTNNLFFL
FCILFTFHTIFSNVQPLNRDPPHGRASWKFTVFAQDEGGEGLVGFTEVQINLKDVNDNAP
QFPNGIAYGNVTENGTIGMHVMTIKAEDYDDINEGTNAKIIYSIEKNAIQEDTGLKIFDI
NPDTGLITTAVCCLDREKTSDYSLQIVATDGGGLKGTGTASIKVKDLNDMPPRFTKDEWY
VEVEETDGSVLPEAPILTVTVNDDDEINNFQYKIIESSGYGADKFAMVKNADGTGSLKVV
QPLDYEDPMQINGFRVRIQVIDNDEIDESDKYHIDHSWVIVKLKDINDNTPRFNKPHIEA
AVYENADVGKNLGTFKAVDIDKGGKSKITYSINRATDRKRQFAIDQEGKVTIQRELDREA
MAKHSLEILATDDGVPPRTAFAILTVLVKDINDNAPVFAEDYRPIMLENSPPSKIIEISA
VDKDDRLEGNGAPFQFRMDPDADDVIRTSFKVEQSNKGDGMAIISSLGSFDREYRKQYTI
PIVIKDSGNPPQTGTSTLTITIGDLNDNIMQPGSKEVIVYNYQGQAPDTPIGRVFVNDLD
DWDTSDKLFYWDEAENPRFKLDDTSGMVTMRHGAREGRYKLRFKIYDRKHAQESYANMSV
VVKHISYEAIVNSGSIRLTGITDEDFIRIWNYRTQNIFRSKLERFRDKLAELLNVDVKNV
DVFSVQMKDRSVPLTDVRFAVHGAYFYKAVQLNGVILLHKEDIEQEVGINIAMVNVDECL
LENADCAGSCTSIIEVESNPCLVNANKTALVGVQINSTAECVCSSREYKQQQTCKSHPCL
NGGRCTDSKSGIKCSCPPGYTGPRCQQVVRSFRGSGWAWYPPLDMCDKSHISVEIITTKP
DGLIFYNGPIKPPKEDETSKQLSDFIALELEQGYPRFLIDYGSGTLELRIATKHPLNDGE
WHRIDLFWDTEQVKMVVDFCKTAEITESDDGNLVEFIDHTCQALGKVPQSNEYLNLNTPL
QIGGVFRDKFDYTYSCWQYMPVGVGFEGCIRNFKHNGILYDLSHPGLSKGSAPGCLYTQE
VCDLNPQVARCLEHGKCVGSYVEAKCECNPGWTGTYCSLPTTPTTFKKHSYVKYALSFEP
DKFVTQIQLRFRTRETYGELFRISDQHMREYGIIELKGAKVYFRYSLNTGQVDEQELALT
AVEVDDGQWHVVKVQRYGSAAILELDGGEGANFNQSFLFDGHQWLSVDKQEGVYAGGKPE
FTGVKTYDVKSDYQKSCIDDISVSGCCFIMFSSCSCPANRLDGKSLPLPPATNGTQWGQA
TMAKNIDRYCSSNNPCQNAYCPDPFDSMFTVKDLFEFNLFRYSCGDGMIISPEGKTCIDR
NECLDYPCFNGGTCINQEPRLKYKCICPDSYWGESCEFLKERQALKFSTSALAAVIACLL
LIISKWKRVLMCFKHYFVDRLKTSFVFVSSFLHATVFLFVYFSCSRRRSANFKKKPVTKD
DIRENIINYCDEGGGENDMTAFDMKTLKIPIGPLPELVQHKAPPVRPDIAVVSDQDVGKV
DVFLEDRKRRVDIDSASGPFDDLRNYAHEGCGSTLGSLSSLQSGTDDEPHEFSFLTTCGP
RFDKLFNIY
Download sequence
Identical sequences Q7Q1M9
AGAP009716-PA|hypothetical 7165.AGAP009716-PA XP_318779.3.40869 AGAP009716-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]