SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP009717-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP009717-PA
Domain Number 1 Region: 969-1198
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.17e-39
Family Laminin G-like module 0.0036
Further Details:      
 
Domain Number 2 Region: 1226-1405
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.6e-30
Family Laminin G-like module 0.0025
Further Details:      
 
Domain Number 3 Region: 461-592
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-27
Family Cadherin 0.0022
Further Details:      
 
Domain Number 4 Region: 230-361
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-22
Family Cadherin 0.00052
Further Details:      
 
Domain Number 5 Region: 1-68
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000002
Family Cadherin 0.0028
Further Details:      
 
Domain Number 6 Region: 571-684
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000209
Family Cadherin 0.0035
Further Details:      
 
Domain Number 7 Region: 61-167
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000186
Family Cadherin 0.0027
Further Details:      
 
Domain Number 8 Region: 348-473
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000928
Family Cadherin 0.0027
Further Details:      
 
Domain Number 9 Region: 1500-1540
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000208
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 10 Region: 686-778
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000214
Family Cadherin 0.013
Further Details:      
 
Weak hits

Sequence:  AGAP009717-PA
Domain Number - Region: 899-986
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00152
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 193-242
Classification Level Classification E-value
Superfamily Cadherin-like 0.00204
Family Cadherin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP009717-PA   Gene: AGAP009717   Transcript: AGAP009717-RA
Sequence length 1727
Comment pep:novel chromosome:AgamP3:3R:40236127:40255901:1 gene:AGAP009717 transcript:AGAP009717-RA
Sequence
VRYKISSGNIDNVFAIRNATGALYVAKALDYEKIKKYELRLKASDNFKENYTTVLINVRD
VNDNPPVFEKSSYRTQITEEDNRGLPKRVLRVTASDADVDRLNNIIYFLTGPGIDIENPS
DSNFDINKATGEIFVLKVVHSIELGIPDTSLTSSKYSISIKASNFVNFLLSQRTKPTQWT
SNVPSLNNTFQSLRSPLNRDPPHGRASWKFTVFAQDEGGEGLVGFTEVQINLKDVNDNAP
QFPNGIAYGNVTENGTIGMHVMTIKAEDYDDINEGTNAKIIYSIEKNVIQEDTGLPIFDI
NPDTGLITTAVCCLDREKTPDYSLQIVATDGGGLKGTGTASIKVKDLNDMPPRFTKDEWF
VEVEETDGSVLPEAPILTVTVNDDDEINNFQYKIIESSGYGADKFAMVKNADGTGSLKVV
QPLDYEDPMQINGFRFRIQVIDNNEIDESDKYHVDHSWVIVKLKDINDNTPRFKKPHIET
AVYENADVRKNLGTFKAVDIDKGGKSKITYSINRATDRKRQFAIDQEGKVTIQRELDREA
MAKHSLEILATDDGVPPRTASAILTVLVKDINDNAPVFAEDYRPILLENSPPSKIIEISA
VDKDDRLEGNGAPFQFRMDPDADDVIRTSFKVEQSNKGDGMAIISSLGSFDREYRKQYTI
PIVIKDSGTPPQTGTSTLTITIGDLNDNIMQPGSKEVIVYNYQGQAPDTLIGRVFVNDLD
DWDTSDKLFYWDEAENPRFKLDDTSGMVTMRHGAREGRYKLRFKIYDRKHAQESYANMSV
VVKHISYEAIVNSGSIRLTGITDEDFIRIGNYRTQNIFRSKLERFRDKLAELLNVDVKNV
DVFSVQMKDRSVPLIDVRFAVHGAYFYKAVQLNGVILLHKEEIEQEVGINITMVNVDECL
LENADCAGSCTSIIEVQSNPCLVNTNKTALVGVQINSTAECVCSSREYKQQQTCKSHPCL
NGGRCTDSKSGIKCSCPPGYTGPRCQQVVRSFRGSGWAWYPPLDMCDKSHISVEIITTKP
DGLIFYNGPITPPKEDDTSKQLSDFIALELEQGYPRLLIDYGSGTLELRIATKHPLNDGE
WHRIDLFWDTEQVKIVVDFCKTAEITETDDGNLVEFVDHTCQALGKVPQFNEYLNLNTPL
QIGGVFRDKFDYTYSRWQYMPVGVGFEGCIRNFKHNGILYDLSHPGLSKGSAPGCLYTQE
VCDLNPQVARCLEHGKCVGSYVEAKCECNPGWTGTYCSLPTTPTTFKTHSYVKYALSFEP
DKFTTQIQLRFRTRETYGELFRISDQHMREYGIIELKGAKVYFRYSLNTGQVEEQEVALT
AVEVDDGQWHVVKVQRYGSAAILELDGGEGANFNQSFSFDGHQWLSVDKQEGVYAGGKPE
FTGVKTYDVKSDYQKSCIDDISVSGCCFIMFSSCSCPANRLDGKSLPLPPATNGTQWGQA
TMAKNIDRYCSSNNPCQNAYCPDPSMFTVKDRLVFEFNLFRYSCGDGMIISPEGKTCIDR
NECLDYPCLNGGTCINQEPRLKYKCICPDSYWGESCEFLKERQALKFSTSALAAVIACLL
LIISKWNRVLMCFKHYFVDRLKTSFVFVSSFLHATVFLFVYFSCSRRRSANFKKKPVTKD
DIRENIINYCDEGGGENDMTAFDMKTLKIPIGPLPELVQHKVPVPSPYLYLLLQCYELCT
SDVFLDDPKRRADIFPASGPFDDLRNYTFEGNGSTSGSPSQVNKNIT
Download sequence
Identical sequences Q7Q1M6
AGAP009717-PA XP_318783.4.40869 7165.AGAP009717-PA AGAP009717-PA|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]