SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP009723-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP009723-PA
Domain Number 1 Region: 971-1200
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.95e-40
Family Laminin G-like module 0.0031
Further Details:      
 
Domain Number 2 Region: 1228-1404
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-29
Family Laminin G-like module 0.0025
Further Details:      
 
Domain Number 3 Region: 463-594
Classification Level Classification E-value
Superfamily Cadherin-like 5.85e-29
Family Cadherin 0.0017
Further Details:      
 
Domain Number 4 Region: 232-363
Classification Level Classification E-value
Superfamily Cadherin-like 2.42e-22
Family Cadherin 0.00054
Further Details:      
 
Domain Number 5 Region: 4-71
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-16
Family Cadherin 0.003
Further Details:      
 
Domain Number 6 Region: 573-686
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000017
Family Cadherin 0.0036
Further Details:      
 
Domain Number 7 Region: 59-143
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000121
Family Cadherin 0.0044
Further Details:      
 
Domain Number 8 Region: 350-475
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000428
Family Cadherin 0.0022
Further Details:      
 
Domain Number 9 Region: 1489-1529
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000243
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 10 Region: 688-781
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000171
Family Cadherin 0.012
Further Details:      
 
Weak hits

Sequence:  AGAP009723-PA
Domain Number - Region: 901-999
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00455
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP009723-PA   Gene: AGAP009723   Transcript: AGAP009723-RA
Sequence length 1751
Comment pep:novel chromosome:AgamP3:3R:41206908:41229906:-1 gene:AGAP009723 transcript:AGAP009723-RA
Sequence
ASGVRYKISSGNVGNVFAIRNTTGALYVAKALDYEKIKKYELRLTASDNFKENYTTVLIN
VRDVNDNPPVFEKSSYRTQITEEDDRGLPKRVLRVTASDADVERPNNIIYFLTGPGIDIE
NPSDSNFDINKATGEIFVLKSLKPFYTNDKAQVKFPVQNLKRLQKQKLAGWRNFSMASLD
SGLLYSFELLPACAKCRPLNRDPPHGRASWKFTVFAQDEGGEGLVGFTEVQINLKDVNDN
APQFPNGIAYGNVTENGTIGMHVMTIKAEDFDDINEGTNAKVIYSIEKNAIEEDTGLPIF
DINPDTGLITTAVCCLDREKTPDYSLQIVATDGGGLKGTGTASIKVKDLNDMPPRFTKDE
WFVEVEETDGSVLPEAPILTVTVNDDDEINNFQYKIIESSGYGADKFAMVKNADGTGSLK
VVQPLDYEDPMQINGFRFRIQVIDNDGIDESDKYHVDHSWVIVKLKDINDNTPRFKKPHI
EAAVYENADVGKNLGTFKAVDIDKGGKSKITYSINRATDRKRQFAIDQEGTVTIQRELDR
EAMAKHSLEILATDDGVPPRTASAILTVLVKDINDNAPVFAEDYRPILLENSPPSKIIEI
SAVDRDDRLKGNGAPFQFRMDPDADDVIRTSFKVEQSNKGDGMAIISSLGSFDREYRKQY
TIPIVIKDSGTPPQTGTSTLTITIGDLNDNIMQPGSKEVIVYNYQGQAPDTPIGRVFVND
LDDWDTSDKLFYWDEAENPRFKLDDTSGMVTMRRGAREGRYKLRFKIYDRKHAQESYANM
SVVVKHISYEAIVNSGSIRLTGITDEDFIRIWNYRTQNIFRSKLERFRDKLAELLNVDVK
NVDVFSVQMKDRSVPLTDVRFAVHGAYFYKAVQLNGVILLHKDEIEQEVGINITMVNVDE
CLLENADCAGSCTSIIEVQTNPCLVNANKTALVGVQINSTAECVCSSREYKQQQTCKSHP
CLNGGRCTDSKSGIKCSCPPGYTGPRCQQVVRSFRGSGWAWYPPLDMCDKSHISVEIITT
KPDGLIFYNGPITPPKEDDTSKQLSDFIALELEQGYPRFLIDYGSGTLELRIATKHPLND
GEWHRIDLFWDTEQVKMVVDFCKTAEITEADDGNLVEFVDHTCQALGKVPQFNEYLNLNT
PLQIGGVFRDKFDYTYSRWQYMPVGVGFEGCIREFKHNGILYDLSHPGLSKGSAPGCLYT
QEVCDLNPQVARCLEHGKCVGSYDEAKCECNPGWTGTYCSLPTTPTTFKTHSYVKYALSF
EPDKFTTQIQLRFRTRETYGELFRISDQHMREYGIIELKGAKVYFRYSLNTGQVEEQEVA
LTAVEVDDGQWHVVKVQRYGSAAILELDGGEGANFNQSFSFDGHQWLSVDKQEGVYAGGK
PEFTGVKTYDVKSDYQKSCIDDIRPRWRRTLTATVPRTILARTRTVRIRSSVSTCGTSTS
ARKCLDVHCERSCVFLVTQLTACFGFNLFRYSCGDGMIISPEGKTCIDRNECLDYPCLNG
GTCINQEPRLKYKCICPDSYWGESCEFLKERQALKFSTSALAAVIACLLLIISKWKVSRC
ALNISLKIFLKTCFVFVTSFPHETVLLFVYFSCSRRRSANFNKKPATKDDIRENIINYCD
EGGGENDMTAFDMKTLKIPIGPLPELVQHKAPPVRPDIAVVSDQVVGKVDVFLDDRKRRV
DIDPASGPFDDLRNYAYEGCGSTSGSLSSLQSGTDDEPHEYSFLTTWGPRFDKLVNIYEP
SKAQIEDDDVS
Download sequence
Identical sequences Q7Q1L9
AGAP009723-PA|hypothetical AGAP009723-PA 7165.AGAP009723-PA XP_318800.4.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]