SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP009725-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP009725-PA
Domain Number 1 Region: 669-778
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-25
Family Cadherin 0.0022
Further Details:      
 
Domain Number 2 Region: 991-1117
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-25
Family Cadherin 0.0019
Further Details:      
 
Domain Number 3 Region: 886-996
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-22
Family Cadherin 0.00086
Further Details:      
 
Domain Number 4 Region: 1221-1313
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-18
Family Cadherin 0.0012
Further Details:      
 
Domain Number 5 Region: 777-893
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-17
Family Cadherin 0.0021
Further Details:      
 
Domain Number 6 Region: 572-681
Classification Level Classification E-value
Superfamily Cadherin-like 9.68e-17
Family Cadherin 0.0056
Further Details:      
 
Domain Number 7 Region: 1101-1231
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000004
Family Cadherin 0.0041
Further Details:      
 
Domain Number 8 Region: 456-550
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000013
Family Cadherin 0.0056
Further Details:      
 
Domain Number 9 Region: 140-232
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000105
Family Cadherin 0.007
Further Details:      
 
Domain Number 10 Region: 220-335
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000171
Family Cadherin 0.0091
Further Details:      
 
Domain Number 11 Region: 402-471
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000186
Family Cadherin 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP009725-PA   Gene: AGAP009725   Transcript: AGAP009725-RA
Sequence length 1325
Comment pep:novel chromosome:AgamP3:3R:41575831:41640871:1 gene:AGAP009725 transcript:AGAP009725-RA
Sequence
NSFISLVLPHDTYPGYSIQKFTANFTGPNAPFSSISSYSSKPLNYRLLETDYSKYFTVLE
DGLVMTTADLSPLVNRPVKLVVLEETPNSTATHQLQLYVMNRKDMLHFPTMLTDVVGQLS
ENKDGGTRVRDIPLLQANSARGAKTVIYSIVGGNEGDAFALEDSSTGTIGTTIRIDDPRK
HGVWLVSAKPLDREHREQYTLAIEATDTKRINKAEVHLPVHITDVNDNRPVFGKPDYRFT
VTGMKATTPAGNETVTWERFTSVGRVEAKDADGDKVAYRLTSPSNTVVIVPQTGELLLAG
EPDAPELFVDVEAHDLRTPSLKSEKPARVLVEFVAPDPLPVILQHSGHEYQHSHRRDKRR
VTRAVRPTKRIEFTEADGDTEGRNVFQLEKETDRETFKIRDENPWVTVETNGAVRVKKKW
DYEELGPEKTIDFWVIITNQGHNAGLKYTDNQRVIIHVKDVNDEPPYFINRPLPMQAVVQ
LNAPPNTPVFTLQARDPDTDHNIHYFIVRDRTGGRFEVDERSGVVRTRGTDLFQLDMEYV
LYVKAEDQNGKVDDRRFQSTPEERLSIVGGKRAPQFYMPSYEAEIPENQKKDSDIISVKA
KSFADREIRYTLKAQGQGAGTFNIGPTSGIVKLAKELDFEDLRQPHVYSLVVTATEDSGG
FSTSVELTIRVTDVNDNAPKFELPDYQAHNVDEDIPLGTSILKVKAMDSDSGANAEIEYL
VSDDHFAVDSNGIIVNNKQLDADNNNAYYEFVVTAKDKGEPAKTGTATVRVYTKNKNDEE
PKFSQQVYTPNVDENAGPNTLVTTVVASDKDGDNVRFGFVGGGTSSGQFVIEEITGVIRL
HSKAISLDRDKYELNVTAMDDGSCCVNGDATIHTSTAVVVVFITDVNDNKPVFKDCGTYY
PKVEEGAPNGSPVIKVQATDEDKGVNGQVKYSIVQQPNQKGTKFTVDEETGEVSTNKVFD
REGDDGKFVSVTVKATDQGEPSLEGVCSFTVEITDVNDNPPLFDRQKYVENVKQDASIGT
NILRVSASDEDADNNGAIVYTLSAPHSPNDLEYFEIQPESGWIVLKKPLDGCYSRERYRL
KVYASDRGDPPSTADVDVELDVVDRNNKPPIWDRTIYGPIHIRENVTVGTVVTSVKASSG
IEGNPTVFYRLMPGSTAQTNKLHTFYLQQRPDNGDTWADIKVNHPLDFEMIKEYNLTVRV
ENNGAQQLASEATVYIQLEDVNDEIPLFTEREQETVLEGEPIGTKVTQVNAIDKDGTFPN
NQVYYYIVDSPRNEGKDFFEINLQSGEIFTKVVFDREKQGAYALEVEARDGAPSARPNSN
QQPNS
Download sequence
Identical sequences A0NFT6
AGAP009725-PA 7165.AGAP009725-PA XP_001238041.2.40869 AGAP009725-PA|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]